(data stored in ACNUC1104 zone)

EMBL: CP001966.PE578

CP001966.PE578       Location/Qualifiers
FT   CDS_pept        complement(617914..618891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0594"
FT                   /product="Protein of unknown function DUF2236"
FT                   /note="PFAM: Protein of unknown function DUF2236; KEGG:
FT                   rer:RER_04190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77232"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU5"
FT                   /inference="protein motif:PFAM:PF09995"
FT                   /protein_id="ADG77232.1"
FT                   /translation="MKLSDGPLRVTDQGFFGPESPTWKVWASPTALIGFQRSVVLEHFD
FT                   PNLTAAVADSAGIYTDPFGRLDRTLAYFLLVATADSKTAIEASEHLMDVHRKATGIEPI
FT                   TGKRYSANNPASQLWIHVTGWHSVLTCYETYGPGPLTPTEEAQYWRDCVLAAELQTCDP
FT                   AEVPTSRDEVRAYFDRVRPGLALTERARRGMHYLLRPRDRGARLRIGGSLIAPATIATL
FT                   PRWMREMGGFDQPRMADAAYPRVVRLAVRAASARHAAGTVALGTLVAPMTGAILRRHFA
FT                   QRAEPAAGVVTPAQARERYGRTASDNADATHSVASSEAPFLTPK"
     atgaagctct cagacggccc tcttcgcgtt accgaccagg gattcttcgg cccagaatct        60
     cccacctgga aggtgtgggc gtctcccacc gcactgatcg gtttccagcg ctccgtggta       120
     ctggagcatt tcgatcccaa tctcacggcc gctgtcgcag actccgccgg catctacacc       180
     gacccgttcg gccgactcga ccggacactc gcctacttcc tgctcgtggc caccgcggat       240
     tcgaagaccg cgatcgaggc gtccgaacac ctgatggatg tgcaccgcaa ggccaccgga       300
     atcgaaccga tcaccggaaa gcgctacagc gccaataatc ccgcatcgca gctgtggatc       360
     cacgtgaccg gctggcactc ggtgctcacc tgctacgaga cgtacggccc cggtccactg       420
     actcccacgg aagaggcgca gtactggcgc gactgcgtgc tcgctgccga gttgcagacc       480
     tgcgatcccg ccgaggtgcc cacctcacgc gatgaggtgc gtgcctactt cgaccgggtc       540
     cggccgggcc tggcgctgac cgaacgcgct cgacgtggca tgcactacct gttgcgcccg       600
     cgcgaccgcg gcgcgcggtt gcggatcggt ggctctctca tcgcccctgc caccatcgcc       660
     acgctgcccc gctggatgcg cgagatgggc ggcttcgacc agccacggat ggccgacgcc       720
     gcctatccgc gggtcgtgcg gctcgcggtg cgagcagcct ccgctcgcca cgccgccggc       780
     accgtcgcac tgggcaccct ggtcgcgccg atgacgggcg ccatcctccg gcggcacttc       840
     gcacagcgag cagaacccgc cgcgggcgtc gtgacgccgg cccaggcccg cgaacggtac       900
     ggccgcacgg cgtccgacaa cgctgatgcg acccactcgg tggcgagcag cgaagcaccg       960
     ttccttactc cgaagtaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page