(data stored in ACNUC1104 zone)

EMBL: CP001966.PE579

CP001966.PE579       Location/Qualifiers
FT   CDS_pept        complement(618937..619848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0595"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: nfa:nfa4290 putative A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; iron-sulfur cluster loop; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77233"
FT                   /db_xref="GOA:D5USU6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU6"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADG77233.1"
FT                   /translation="MQRSHDPGPKIDSDFTSVLHWFDRTERDLPWRADGVTPWQILMSE
FT                   VMLQQTPVVRVEAMWREWVRRWPTPADLAAATGADAVRAWGKLGYPRRAMRLHACAQAI
FT                   VAEHAGVVPETVEELLALPGIGDYTARAVACFAFGQDVPVVDINVRRVLARAVAGDSDA
FT                   AAPSARRDLAAATEVLETVPAQRRPRLSAALMELGALVCTARSPRCGECPVHAGCAWLA
FT                   AGAPEGTVAPRKVQKYEGTDRQARGRLLDVLRAADGAVPRAALDLAWERDTAQRDRALD
FT                   SLLLDGLIEQTDDGRFALSGEA"
     gtgcagcgct ctcacgaccc gggcccgaag atcgattcgg atttcacatc ggtccttcat        60
     tggttcgaca gaactgaacg agacctcccg tggcgggccg acggcgtgac gccgtggcag       120
     atcctgatga gcgaggtgat gctgcagcag acgccggtgg tccgagtgga agcgatgtgg       180
     cgggagtggg ttcgtcgctg gccgacaccc gccgatctcg ctgccgcgac cggcgcagac       240
     gccgtgcggg cgtggggcaa gctcggctat ccgcggcgcg ccatgcggct acacgcatgc       300
     gcgcaggcga tcgtggcaga gcacgccggg gtggtgcccg agaccgtcga ggagcttctt       360
     gcgctgccgg gaatcggcga ctacaccgca cgggcggtgg cgtgtttcgc cttcggacag       420
     gacgtcccgg tggtcgacat caacgtgcgg cgggtcctgg cccgcgccgt tgcgggcgac       480
     tccgacgcag cggcgccgtc cgcccggcgc gacctggcgg cggccaccga ggttctggaa       540
     acggttccgg cgcagcgccg gccgcgactg tccgcagcgc tgatggaact cggagccctg       600
     gtatgtaccg cccggtcgcc acggtgcggc gagtgtccgg tgcacgcggg gtgcgcgtgg       660
     ctcgccgccg gggcaccgga gggcaccgtg gccccgcgga aggtccagaa gtacgaggga       720
     acggaccggc aggcgcgcgg acgactgctc gatgtgctgc gcgcggccga cggtgccgtg       780
     ccgcgcgcgg cactcgacct ggcctgggaa cgtgacaccg cgcaacgtga ccgggcgctg       840
     gattcactcc tactcgacgg tctcatcgag cagaccgatg acggccggtt cgcgctgtcc       900
     ggcgaggcct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page