(data stored in ACNUC1104 zone)

EMBL: CP001966.PE583

CP001966.PE583       Location/Qualifiers
FT   CDS_pept        complement(622465..623850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0599"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: rop:ROP_43750 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77237"
FT                   /db_xref="GOA:D5USV0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADG77237.1"
FT                   /translation="MAKPKVQYTCSECGHTVAKWVGRCPSCGAWSTMEEGAPARVGGGS
FT                   GPTAHVGLTLPSTPAVPITRIDPNSTRALPVGIGELDRVLGGGIVPGSVILLAGEPGVG
FT                   KSTLLLDVVHRWASTGRGKSLYVTGEESAGQVRLRAERTGALSDELYLAAESDLGTVLG
FT                   HVEQISPTLMVVDSVQTLSASGVDGVHGGVTQVRAITATLTSLAKASGIAVILVGHVTK
FT                   DGAVAGPRSLEHLVDVVLSFEGDKHSTLRMVRGIKNRFGASDEVGCFEQRESGIAQVTD
FT                   PSGLFLHHRDQAAAGTAVTVGLDGKRPMLGELQALVTPTPLPQPRRAVSGLDSARVAMI
FT                   LAVLTKHGGIENLAQKDVYAATVGGMKITEPAADLALALAIASGAADTALRPNTVVLGE
FT                   VGLAGEVRRVTGVERRLAEAHRMGFTHAIVPPAQERLRVGDMRIAEAATVAEAVRLSRQ
FT                   RKG"
     atcgccaagc ccaaggtgca gtacacctgc tccgaatgcg gtcacaccgt ggccaagtgg        60
     gtcggccgct gcccgtcgtg cggcgcctgg tccacgatgg aggagggtgc gcccgcccgt       120
     gtcggaggag gctccggccc caccgcgcac gtggggctga cgctcccgtc cacccccgca       180
     gtgccgatca cccggatcga cccgaactcc acgcgggccc tacccgtggg gatcggcgaa       240
     ctcgatcgcg tgctgggcgg cggcatcgtc cccggctccg tgatcctgct ggccggcgaa       300
     cccggcgtcg ggaagtcgac gctgctactc gacgtggtgc accgctgggc ctcgacgggt       360
     cgcgggaaat ccctttacgt gaccggtgag gagtctgcgg ggcaggtccg gttgcgcgcc       420
     gagcgcaccg gcgccctctc cgacgagctc tatctcgcag ccgaatccga tctcggaacg       480
     gttctcggcc acgtcgagca gatctccccc actctcatgg tggtcgactc ggtgcagacc       540
     ctgtcggcct ccggcgtcga cggggtgcac ggcggcgtca cgcaggtccg cgcgatcact       600
     gccaccctca cctcgctggc gaaggcctcc gggatcgcgg tgatcctcgt cggccacgtc       660
     accaaggacg gcgccgtcgc cgggccccgg tcgctggagc atctggtcga cgtcgtactc       720
     agcttcgagg gtgacaagca ctccacgctg cgtatggtgc gcggcatcaa gaaccgcttc       780
     ggcgcgtccg acgaagtggg ctgcttcgaa cagcgcgagt ccggcatcgc tcaggtcacc       840
     gacccgtcgg ggttgttcct gcaccaccgc gaccaggccg cggccggtac cgcggtcacc       900
     gtcggtctcg acggtaagcg tcccatgctg ggcgagctcc aggccctcgt gacgcccacc       960
     ccgctgccgc agccgcggcg cgcggtgtcc ggcctggact cggcccgggt ggcgatgatc      1020
     ctggccgtgc tgaccaaaca cggcggcatc gagaacctgg cacagaagga cgtctacgcg      1080
     gcgaccgtcg ggggcatgaa gatcaccgag ccggccgccg acctcgcgct ggcgctggcc      1140
     atcgcatccg gtgccgccga taccgcgttg cggccgaata cggtggtgct gggcgaagtg      1200
     ggcctggccg gagaggtgcg ccgcgtgacc ggcgtcgaac gccgcctcgc cgaggcccac      1260
     cggatgggat tcacccatgc gatcgtgccg cccgcgcagg agaggctgcg ggtgggcgat      1320
     atgcggatcg ccgaagccgc cacggtcgcc gaggccgtcc gcctctcaag gcaacgcaag      1380
     ggttaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page