(data stored in ACNUC1104 zone)

EMBL: CP001966.PE586

CP001966.PE586       Location/Qualifiers
FT   CDS_pept        625302..625964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0602"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: rha:RHA1_ro04460 2-C-methyl-D-erythritol 4-
FT                   phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77240"
FT                   /db_xref="GOA:D5USV3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV3"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADG77240.1"
FT                   /translation="MTVVALVPAAGQGTRLGLNRPKAFVTLQGRSLLERAVDGLFASGA
FT                   VDEVVVMVPADLVDDARALVPRARVVVGGAERTDSVRAGLAAAGDADLVLVHDAARPLT
FT                   PGPMIHRVVAALREGASAVIPVLPVADTIKRVDAGGAVAATVDRADLRAVQTPQGFTAQ
FT                   ALRAAYDAAPNESATDDAGLVERAGGTVATVTGDPLAMKITTAFDLRIAEVLAQEHK"
     ctgaccgtcg tcgcgctggt ccccgccgct gggcagggga cgcgcttggg cctcaatcgg        60
     cccaaggcct tcgtgactct gcagggccgt tcactgctcg aaagggcggt ggacggcctg       120
     ttcgcgtccg gggcggtcga cgaggtggtc gtcatggtgc ccgccgacct ggtcgatgat       180
     gcccgcgccc tcgtcccgcg tgcccgcgtc gtcgtgggtg gggctgaacg cacggactcc       240
     gtgcgggccg gcctcgccgc cgcgggcgac gccgatctgg tgctggtgca tgacgccgcc       300
     cgaccgttga cgccgggacc gatgatccac cgagtggtcg cagccctgcg ggagggggcg       360
     agcgcggtca ttcccgtgct gcccgtcgcc gacaccatca aacgcgtgga tgccggcggt       420
     gccgtcgccg ctaccgtcga ccgggccgac ctgcgggccg tgcagacgcc ccagggattc       480
     accgcgcagg ctctgcgcgc cgcctacgat gcggcgccca acgagtcggc cacggacgat       540
     gcgggtctgg tcgagcgggc cggcggcacc gtcgctaccg tgaccggcga cccgctcgcg       600
     atgaagatca ccaccgcctt cgatctgcgg atcgcggaag ttcttgcgca ggagcacaaa       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page