(data stored in ACNUC1104 zone)

EMBL: CP001966.PE587

CP001966.PE587       Location/Qualifiers
FT   CDS_pept        625961..626434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0603"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; KEGG: mjl:Mjls_5124
FT                   2-C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77241"
FT                   /db_xref="GOA:D5USV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADG77241.1"
FT                   /translation="MIIPRVGIGTDVHPVEPGRECWMLGLLFDGDGCSGHSDGDVAVHA
FT                   LCDALLSAGGLGDLGTVFGVGRSDNVGITGAEMLTHVRTLLSEAGFAVGNAAVQLIGNR
FT                   PKVGPRRDEAQQVLSELLGAPVSVSATTTDGLGLTGRGEGIAAVATALIYAAS"
     atgataattc cccgcgtcgg tatcggtacc gatgtccacc ctgtcgagcc gggccgggaa        60
     tgctggatgc tcgggctgct cttcgacggg gacggctgct ccgggcactc cgacggcgac       120
     gtggccgtgc acgccctgtg cgatgcgctg ctctccgctg gcggcctcgg cgacctcggc       180
     accgtcttcg gggtgggccg ctccgacaac gtcggcatca ccggcgccga gatgctcacc       240
     cacgtgcgga cactgctgtc cgaggccggc ttcgccgtcg gcaacgccgc agtgcaactg       300
     atcgggaacc ggcccaaggt cgggccgcgg cgcgacgagg cgcaacaggt gctgagcgag       360
     ctgctcggcg ccccggtctc cgtctccgcc accacgaccg acggcctcgg tctcaccggc       420
     cgcggtgagg gcatcgcggc ggtggcgacg gcgctgatct acgccgcgag ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page