(data stored in ACNUC1104 zone)

EMBL: CP001966.PE589

CP001966.PE589       Location/Qualifiers
FT   CDS_pept        627428..628825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0605"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   rha:RHA1_ro04462 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77243"
FT                   /db_xref="GOA:D5USV6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADG77243.1"
FT                   /translation="MTLRLYDSLTREVRDFVPLVEGKAGIYLCGATVQGVPHIGHIRSG
FT                   VAFDVLRRWLLATGLDVAFVRNVTDIDDKILRKAAEAGRPWWEWAATHEREFTRAYDAL
FT                   GVLPPSAEPRATGFITQMVTYMERMIERGHAYASAGDVYFSVRSLPDYGALSRQKVDDV
FT                   QQGETLAAGKRDPLDFTLWKAAKPGEPSWPSPWGDGRPGWHLECSAMATSYLGGQFDIH
FT                   CGGMDLVFPHHENEIAQAHGAGDPFANYWLHNGWVTMSGEKMSKSLGNVVSIPNLLTQV
FT                   RAVELRYYLGSAHYRSMQEYSAGALAEAATAYGRIESFVQRTVERTGEVPVGQWSAGFA
FT                   AALDDDLGVPSALAEVHAAVRAGNAALEAGDLDEARRLAGAVRAMTSILGVDPLDPHWV
FT                   TENAGDGAAMDALGVLVQAELERRAAARAEKNWAEADAARDRLHAAGIDVTDGADGSSW
FT                   TLAKKTQ"
     gtgacgctgc gcctgtacga ctccctgacc cgcgaggttc gtgacttcgt gcccctcgtc        60
     gagggcaagg ccggcatcta cctctgtggc gccaccgtgc agggcgtgcc ccatatcggg       120
     cacatccgca gcggtgtcgc cttcgacgtg ctgcgccgct ggcttctcgc cacgggcctg       180
     gacgtggcgt tcgtgcgcaa cgtgaccgat atcgacgaca agatcctgcg caaggccgcc       240
     gaggcgggcc gcccctggtg ggaatgggcc gcgacgcatg agcgcgagtt cacccgcgcc       300
     tacgacgcgc tcggcgtgct gccgccgtcc gccgagccgc gggccaccgg cttcatcacc       360
     cagatggtca cctacatgga gcggatgatc gagcgcgggc atgcgtacgc ctccgccggg       420
     gatgtgtact tctccgtccg ttcactgccc gactacggcg cgctgagccg gcagaaggtc       480
     gacgacgtgc agcagggcga gacccttgcc gcgggcaagc gtgatccgct ggacttcacg       540
     ttgtggaagg cggcgaagcc gggtgagccg agctggccct ccccgtgggg ggacggccgt       600
     ccgggctggc atctggagtg ctccgcgatg gccacgagct acctcggtgg gcagttcgat       660
     atccactgcg gtggtatgga tctggtgttc ccgcaccacg agaacgagat cgcgcaggcg       720
     catggtgcgg gagacccgtt cgcgaactac tggctgcaca acggctgggt caccatgtcc       780
     ggcgagaaga tgagcaaatc gctcggcaac gtggtctcca tcccgaacct gctcacccag       840
     gttcgtgccg tcgaattgcg ctactacctc ggttcggcgc attaccggtc gatgcaggag       900
     tattcggccg gcgcgctcgc cgaggccgcc accgcgtacg ggcgcatcga atccttcgtc       960
     cagcgcaccg tcgagcgaac gggtgaggtc ccggtcgggc agtggtccgc cggtttcgcg      1020
     gccgccctcg atgacgatct cggcgtaccg tcggctctgg cggaagtgca cgccgccgtg      1080
     cgcgccggaa acgcggccct ggaggccggc gatctcgacg aggcacggcg gctggcgggt      1140
     gcggtgcggg cgatgacgtc gatcctcggc gtcgacccgc tggatccgca ctgggtcacc      1200
     gagaacgccg gtgacggtgc cgccatggat gcgctgggcg tgctggtgca ggccgagctg      1260
     gagcgtcgcg cggccgcccg ggccgagaag aactgggcgg aggccgacgc tgcgcgcgac      1320
     cggctgcacg ccgcggggat cgacgtgacc gacggtgccg acgggtccag ctggaccctg      1380
     gccaagaaga ctcagtag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page