(data stored in ACNUC1104 zone)

EMBL: CP001966.PE59

CP001966.PE59        Location/Qualifiers
FT   CDS_pept        complement(59652..60677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0961c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76713"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU5"
FT                   /inference="similar to AA sequence:KEGG:MAP0961c"
FT                   /protein_id="ADG76713.1"
FT                   /translation="MSGRRLLWLSPWMRPLARVYCEALEDRGWEVVLVTSDQHPESDAA
FT                   RPYEWVLNPRPKTPSTWAPFARRLRDARRFAPHVVVTELVRDPRWIALAGSAPRVRLVH
FT                   DDRPHDAAEEVPRWERALFDRWNGSAAATVAFSEYVRAEIGADALAPLTSDLAEMLVPP
FT                   MVPATERRDFVAVGRLNGYKNLDVTLDAWERHATGPGWRGDELVLIGDGDAPLRAAPHV
FT                   RRVPGAYSYADVIGPLAAAKGSVAHYRRATQSGVQVLAMQLGVTPIVSDRGALPEFQPP
FT                   GEAAIGVDDVAGLAAAFDALADPEAAARRGAVARAHYLARYGADESAARLEEMLSRVAR
FT                   I"
     gtgagcggcc ggcgcctgct gtggctctcc ccgtggatgc gtccactggc ccgggtctac        60
     tgcgaggcgc ttgaggaccg gggctgggag gtagtgctgg ttacctccga ccagcacccc       120
     gaatccgatg ccgcccggcc gtacgagtgg gtgctgaatc cacggccgaa gacaccctcc       180
     acctgggcgc cgttcgcccg ccgcctgcgc gacgcgcgtc ggttcgcccc gcacgtcgtg       240
     gtcaccgagc tggtgcgtga cccgcggtgg atcgccctcg ccggcagcgc cccccgcgtc       300
     cggctcgtgc acgacgaccg cccgcacgac gccgcggagg aggtaccccg atgggaacgc       360
     gcgctgttcg atcgctggaa cgggtccgca gcggccacgg tggcgttcag cgagtacgtg       420
     cgggccgaga tcggcgcgga cgctctggca ccgctgacca gtgatctcgc cgaaatgctc       480
     gtgccgccga tggttccggc cacggagcga cgcgatttcg tggccgtagg ccggctcaac       540
     ggctacaaga acctggacgt cacgctcgac gcctgggaac ggcacgccac cgggcccggt       600
     tggcgtggag acgaactcgt attgatcggc gacggtgatg ccccgctgcg ggcggcgccg       660
     cacgtgcgcc gggtgccggg cgcgtattcc tacgccgatg tgatcggccc cctcgctgcc       720
     gcgaagggat cggtggcgca ctaccgccgg gccacgcaga gcggggtcca agtgctggcg       780
     atgcagctcg gggtgacccc catcgtctcc gaccggggtg cgctgcccga gttccagccg       840
     ccgggcgaag cggccatcgg ggtggacgac gtcgcgggtc ttgcggccgc gttcgacgcg       900
     ctcgccgatc cggaggccgc ggcacgccgg ggcgccgtcg ctcgggcgca ctacctcgcg       960
     aggtacggcg ccgacgaatc cgccgcacgg ctcgaggaga tgctcagccg cgtcgcacgg      1020
     atctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page