(data stored in ACNUC1104 zone)

EMBL: CP001966.PE590

CP001966.PE590       Location/Qualifiers
FT   CDS_pept        628840..629814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0606"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: nfa:nfa4390 putative tRNA/rRNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU);
FT                   RNA 2-O ribose methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77244"
FT                   /db_xref="GOA:D5USV7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV7"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG77244.1"
FT                   /translation="MAGNSQRRGAVRKSGTKKGQVTGSGGVRRRGLEGRGATPAAKDRP
FT                   YHPAHKKARAAAKAAANPQRRPQKVAGRAAEDGPEYVLGRNPVVECLRADVPATALYVA
FT                   VGAQNDERLTESVRMAADKGISILEVQRAELDRMSENGLHQGIALQIPPYSYAHPEDLL
FT                   RRAADRGEAPMIVALDNITDPRNLGAVIRSAAAFGGHGVVIPSRRSAAITAVTWRTSAG
FT                   AAARLPVAQAPNLNRTLADYAAAGLQIVGLDAGGDVTLDDYRADTGVVVVVGSEGKGLS
FT                   RLVRENCDSILSIPIASSVESLNASVAAGVVLADFARQRRNRN"
     atggcgggca attcccagcg ccgcggcgcg gttcgcaagt ccggcaccaa gaaggggcag        60
     gtcaccgggt cgggtggcgt gcggcgtcgc gggctcgagg gccgcggcgc gaccccggcg       120
     gcgaaggacc gtccgtacca ccccgcgcac aagaaggccc gggccgctgc caaggcggcc       180
     gcgaacccgc aacgccggcc gcagaaggtg gccggccgcg cagccgagga cggtcccgag       240
     tacgtgctcg gccgcaatcc cgtggtcgag tgcctacgcg cggacgttcc cgcgacggcg       300
     ttgtacgtgg cggtcggcgc tcagaacgac gagcggctca ccgaatcggt gcggatggcc       360
     gccgacaagg gcatctcgat cctcgaggtg cagcgggccg agctggaccg gatgagcgag       420
     aacggactgc accagggcat cgccctgcag atcccgccgt acagctacgc gcaccccgaa       480
     gatctgctgc gccgcgccgc cgaccgtggc gaagccccga tgatcgtggc cctcgacaac       540
     atcaccgacc cgcgcaacct gggcgcggtg atccggtcgg cggccgcgtt cggcgggcac       600
     ggcgtggtca tcccgtcccg acggtccgcg gccatcaccg ccgtcacgtg gcgcacctcc       660
     gcgggggccg cggcgcggct gcccgttgcg caggcgccga acctgaaccg caccctggcc       720
     gattacgccg ccgcgggact gcagatcgtc ggcctggatg ccggcggcga cgtgacgctc       780
     gacgactacc gcgccgacac cggtgtggtg gtggtggtcg gatccgaggg caagggcctc       840
     tcgcgcctgg tccgcgagaa ttgcgactcc attctctcca tccccattgc ttcctcggtg       900
     gaatcgctca acgcatcggt cgcggcgggc gtggtcctgg cggacttcgc acgacagcga       960
     cgaaatcgaa actga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page