(data stored in ACNUC1104 zone)

EMBL: CP001966.PE592

CP001966.PE592       Location/Qualifiers
FT   CDS_pept        complement(630461..631222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0608"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: rer:RER_07000
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77246"
FT                   /db_xref="GOA:D5USV9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADG77246.1"
FT                   /translation="MTQRIDLNADCGESYGAWRLGDDDALLGIVSSANVACGFHAGDPS
FT                   TLRATCARAVEQGVRIGAQVGYADVRGFGRRFIEVPPADLTADVIYQIGALQAIARSVG
FT                   GEVTYVKPHGALYNAIVGHTSQARAVVDGVLACTSGLPVLGLPGSEFLRIAAEQGLHPV
FT                   AEAFADRAYTPEGTLVPRSHPGSVLHDPDEIAARVVRMVFDDTVEAIDGTEVELHADSV
FT                   CLHGDNPEAVRVAARLRTVLEGAGAEIAPFN"
     gtgacccagc gcatcgacct caacgccgac tgcggcgagt cctacggcgc ctggcgcctc        60
     ggtgacgacg acgccctcct cgggatcgtc tcctcggcca acgtcgcctg cggcttccat       120
     gccggcgacc cgtccaccct gcgcgcgacg tgtgcccgcg ctgtcgagca gggcgtgcgg       180
     atcggcgccc aagtcggcta tgccgatgtg cgcggcttcg gccgccggtt catcgaggtg       240
     ccgcccgccg atctcaccgc cgatgtgatc tatcagatcg gcgctcttca ggcgatcgcc       300
     cgcagtgtgg gcggcgaggt cacgtacgtg aaaccgcacg gcgcgctcta caacgcgatc       360
     gtcgggcata cgtcccaggc acgcgccgtg gtcgacggcg tcctggcctg cacatccggg       420
     ttgcccgtgc tcggcctgcc cgggtccgaa ttcctgcgga tcgccgcaga gcagggcctg       480
     cacccggtgg ccgaagcctt cgccgatcgt gcctacacac ccgagggcac gctcgtgccg       540
     cgctcccacc cggggtcggt gctccacgac cccgacgaga tcgctgcccg cgtggtccgg       600
     atggtcttcg acgacacggt cgaggccatc gacggcaccg aagtcgagct gcacgccgat       660
     tcggtgtgcc tgcacggtga caaccccgag gcggtgcgag tggccgcccg cctccggacc       720
     gtcctggagg gcgccggagc ggagatcgct ccgttcaact ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page