(data stored in ACNUC1104 zone)

EMBL: CP001966.PE597

CP001966.PE597       Location/Qualifiers
FT   CDS_pept        634359..634916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0613"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: Transcriptional regulator PadR-like;
FT                   transcriptional regulator PadR family protein; KEGG:
FT                   mav:MAV_0135 transcriptional regulator, PadR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77251"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW4"
FT                   /inference="protein motif:PFAM:PF10400"
FT                   /protein_id="ADG77251.1"
FT                   /translation="MALRHAILATLLVVEEASGYDLAKEFDGARAHFWTATPQQLYREL
FT                   DRMEADGAIVARTVEQEKRPNKRVFRVTADGRTELAAFSERSPKPMAIRDDFLVMVQGA
FT                   QAGDVAAICANLRLRRDAAAAKLAHYERVRARWLEGRTEAGLLADHRLGGPYLTLLRGL
FT                   RFEQENLDWYDLALPVLEARLP"
     atggcgctac ggcacgcgat cctggcgacc ctgctcgtgg tcgaggaggc gtccggctac        60
     gacctggcca aggagttcga cggtgcccgc gcccacttct ggaccgccac gccgcagcag       120
     ctgtaccggg aactggaccg tatggaggct gacggggcga ttgtcgcccg caccgtcgag       180
     caggagaagc ggccgaacaa acgggtcttc cgggtgacgg cggacggtcg tacggaactc       240
     gccgcgttca gtgagcgatc accgaaaccg atggcgatcc gggacgactt cctggtgatg       300
     gtgcaggggg cgcaggccgg agacgtggcc gcgatctgcg cgaatctgcg gttgcggcgc       360
     gacgctgcgg ccgcgaagct ggcccactac gagcgggtgc gggcgcgctg gctggagggg       420
     cgcaccgaag ccggactgct cgccgaccat cggctcggtg gtccctatct gacgctgttg       480
     cgcggcctcc ggttcgagca ggagaatctg gactggtacg acctcgccct gccggtgctc       540
     gaagcgcgcc taccctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page