(data stored in ACNUC1104 zone)

EMBL: CP001966.PE6

CP001966.PE6         Location/Qualifiers
FT   CDS_pept        6380..7675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0006"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   fre:Franean1_0073 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76660"
FT                   /db_xref="GOA:D5UPA8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA8"
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /protein_id="ADG76660.1"
FT                   /translation="MRIAIACMGSRGDISPLLAVGRVFADRGDTVTIGCTVESRDFVRS
FT                   HGFEPRILTTLNLKEFLQSPLGQEKFFGTGTATQLRAVGKLADSHADEFDEHLAQLCAD
FT                   VDCVISTRIIEERAALVTHRNGTPLVMLEYFPGDAHSTVPNPLLGPRLQDITATIPVLL
FT                   PLTYRIFDIGWALSIAKKTLHLAKRVGYPRRIINPRSVLNGRDILRVEAFGTALVPPRT
FT                   RSDARQPRIGFIRIEGRPADRAARDRAVEAWIDSDDRPFVYLGFGSMPIVDFDGVVTEL
FT                   AATLAGEGLRLIAVPGWSARTGDEVVETPDLLVLPDIDHDAVFPRCAAIVHHGGAGTTA
FT                   IAAASGRPSLVCSQAFDQHFWGRRIEAAGAGALLSRRRMSARTIAEAVLSLVRDDAVVA
FT                   GARRLGEVAAEDLRGRDQFIEAFDAFVAETGR"
     gtgcgcattg cgatcgcttg tatgggttcg cgcggcgata tcagccccct tctggcagtg        60
     ggccgcgtgt tcgccgaccg cggcgacacc gtgacgatcg gctgcacggt cgaatcccgg       120
     gacttcgtgc gctcgcacgg attcgagccg cgcattctga ccaccctcaa tctcaaggaa       180
     ttcctccaat cgcctctcgg gcaggagaag ttcttcggta ccggcaccgc cacgcagcta       240
     cgggccgtgg gcaaactggc agactcgcac gccgacgagt tcgacgagca cctcgcgcag       300
     ttgtgcgcgg acgtcgactg cgtgatcagc accaggatca tcgaagagcg cgcggccctg       360
     gtcacccacc ggaacggcac accgctggtg atgctcgagt acttcccggg cgatgcgcac       420
     agcaccgtgc cgaatccctt gctcggaccg cggctccagg acatcaccgc cacgatcccg       480
     gtactgctgc cgctcaccta ccggatcttc gatatcggct gggccctcag catcgccaag       540
     aagactctgc acctggccaa gcgcgtcggc tatccccggc ggatcatcaa cccgcggtct       600
     gttctcaacg gccgtgacat ccttcgcgtc gaggccttcg gcaccgcgct ggtaccgccg       660
     cgcacgcgga gcgacgcgcg gcagcctcgg atcggattca tccggatcga gggccgtccc       720
     gcggatcgcg ccgcccgtga ccgggcggtc gaggcgtgga tcgacagcga cgaccgtccg       780
     ttcgtctacc tgggtttcgg cagcatgccg atcgtcgact tcgacggcgt ggtgacggaa       840
     ctcgccgcca ccctggccgg tgagggacta cgcttgatcg ccgtccccgg atggtctgcg       900
     cgcacgggcg acgaggtcgt cgagacgccg gacctgctgg tgctgccgga tatcgaccac       960
     gacgcggttt tcccgcgctg cgcggcgatc gtccatcacg gcggcgccgg gaccaccgcc      1020
     atcgcagcgg cctccggtcg gccctcactg gtctgcagtc aggccttcga tcagcacttc      1080
     tggggtcggc ggatcgaggc agccggtgcc ggtgcgctgc tctcgcgccg tcggatgtcg      1140
     gcgcgcacga tcgccgaggc agtgctctcg ctggtgcgcg acgatgcggt ggtggcgggt      1200
     gcacgccggc tcggcgaggt agcggcggaa gacctgcgcg ggcgtgacca gttcatcgag      1260
     gccttcgacg cgttcgtggc cgagaccggt cgttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page