(data stored in ACNUC1104 zone)

EMBL: CP001966.PE600

CP001966.PE600       Location/Qualifiers
FT   CDS_pept        636389..636988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0616"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /note="KEGG: art:Arth_4077 protocatechuate 3,4-
FT                   dioxygenase, alpha subunit; TIGRFAM: protocatechuate
FT                   3,4-dioxygenase, alpha subunit; PFAM: intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77254"
FT                   /db_xref="GOA:D5USW7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW7"
FT                   /inference="protein motif:TFAM:TIGR02423"
FT                   /protein_id="ADG77254.1"
FT                   /translation="MTARSRTPDQTIGPFFGDGLSLPGAEHLIAPGHPRAIRLSGTVFD
FT                   GAGDPVPDCLLEIWQPDEQGRPARPAALIPRDGHSLQGWVRDPHDFAGWGRAATGHTGR
FT                   FGFTTVEPGPAQPGAAPFISVAVFARGLLTGLFTRVYPPEATAALAADPLLSTLPTDRR
FT                   STVIAQRGDDGSLRWDIRLQGERETVFLDFVGAGAR"
     atgaccgcac gctcacgcac tcccgatcag accatcggcc ccttcttcgg tgacggcctc        60
     tctctccccg gcgccgaaca cctcatcgca cccggtcatc cccgggcgat ccggctgtcc       120
     ggcaccgtct tcgacggcgc cggggacccg gtccccgact gcctgctgga gatctggcag       180
     cccgacgaac aaggccgccc cgcgcggccg gcggcactca tcccgcgcga cggtcactcg       240
     ctccagggct gggtgcgcga tcctcacgat ttcgccgggt gggggcgtgc cgccacgggc       300
     cacacgggtc gattcggatt caccacggtc gagccggggc cggcgcaacc cggtgccgcg       360
     ccgttcatct cggtcgcggt gttcgcccgg ggtttgctca ccggactgtt cactcgggtc       420
     tacccgcccg aggcgaccgc tgctctggcg gccgatccgc tgctgtccac tctgcccacc       480
     gaccgccgat ccaccgtgat cgcccagcgc ggcgacgatg gctccctccg gtgggacatc       540
     aggctccagg gtgagcggga gacggtcttc ctcgacttcg tcggcgcggg tgcgcgatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page