(data stored in ACNUC1104 zone)

EMBL: CP001966.PE607

CP001966.PE607       Location/Qualifiers
FT   CDS_pept        643089..644366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0623"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: sco:SCO7435 transmembrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77261"
FT                   /db_xref="GOA:D5USX4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77261.1"
FT                   /translation="MASTPLTPAAADAALRSVGSPRAWGALLCWMVVVFEGYDLVSLGA
FT                   AIPALLDTGHLGMTASDLRAVATVSLVGVGIGAAVTGAISDRYGRRGPLVACVLLFSVF
FT                   TLLVPVMPTVWALAAVRFIAGLGMGGCMPVALTAMQEAAPERKSNASAVTMTGYHVGAV
FT                   LASLIALLAGNSWQWLFYGGGILGLLLVPVIALRMPETAVVAGTAKPIAAQRADRASVL
FT                   QAPYLRTTLMLFVAAFLGLLVVYGLNTWLPQLMRGAGYPVSTALVMLLVLNVGAVAGLM
FT                   IGGRVADRLGAQRVTVLWFAAASVMLALLSIKVANQVVLDVVIFVTGFFVFTAQVLLYG
FT                   LIGYLYPRTKVGTAMGLVSAVGRLGAIAGPWVTGSLVVAGIGYPWGFYFFAVAAGLAAL
FT                   AVVAVPRPAREEQAADSAAEQAARVA"
     atggcatcca caccactgac cccggccgcg gcggacgcag cgctgcgctc ggtaggttca        60
     ccgagagcct ggggcgcgtt gctgtgctgg atggtcgtcg tgttcgaggg gtacgacctg       120
     gtgtcccttg gcgccgcgat tcccgcgctg ctcgacaccg ggcacctcgg aatgaccgca       180
     tcggacctgc gcgccgtcgc cacggtctcg ctggtcggcg tcggcatcgg tgcggcggtc       240
     accggtgcga tctccgaccg ctacggacgc cgcggcccac tcgtggcgtg cgtgctgttg       300
     ttctccgtgt tcacgctgct ggttccggtc atgcccacgg tgtgggcgct cgccgccgtc       360
     cggttcatcg ccggcctcgg catgggcggc tgtatgccgg tggcgctcac tgcaatgcaa       420
     gaggctgcgc ccgagcgaaa atcgaacgcc agcgcggtca cgatgaccgg ctatcacgtg       480
     ggtgcagtcc tggcctcgct gatcgcattg ctcgccggaa actcgtggca gtggctgttc       540
     tacggcggcg gtatcctcgg cctgctgttg gttccggtga tcgctctccg catgccggag       600
     accgccgtcg tggccgggac cgccaaaccg attgcggcgc agcgtgccga tcgtgcgtcg       660
     gtgctgcagg cgccgtacct gcggaccacg ctcatgctgt tcgtcgccgc cttcttgggg       720
     ctgctggtgg tgtacgggct caacacctgg ctgccgcaac tgatgcgtgg cgccggttac       780
     ccggtgtcca ccgcgctggt gatgctgctg gtgttgaacg tgggcgcggt ggccggtttg       840
     atgatcggcg gcagggtcgc ggaccgtctt ggcgcgcaac gggtcacggt gttgtggttc       900
     gccgctgcca gcgtgatgct ggcgctgctg agcatcaagg tggccaacca ggtggtgctc       960
     gacgtggtga tcttcgtgac cggattcttc gtgttcactg cgcaggtgct gctgtacggc      1020
     ctgatcggat acctctatcc ccgaacgaag gtcggtaccg cgatgggcct ggtctccgcg      1080
     gtcgggcgcc tcggtgccat cgccgggccg tgggtcacgg gcagcctcgt cgtggccggt      1140
     atcggatatc cctggggctt ctacttcttc gccgtcgcgg caggcctggc ggcgctggcc      1200
     gtggtcgcgg tgccgcggcc cgctcgcgag gagcaggctg cggattcagc cgcggaacag      1260
     gccgcgcgcg tggcgtga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page