(data stored in ACNUC1104 zone)

EMBL: CP001966.PE609

CP001966.PE609       Location/Qualifiers
FT   CDS_pept        645623..646222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77263"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77263.1"
FT                   /translation="MDTETMVEELQELIADLARERVRAGEEDGDGLEIRLDLDPDGQVI
FT                   ATAAPAPPATEAEIAQAEAALGRPYPPELRALLGVANGFPGYFYGDTLLGTSGVGTAGV
FT                   AGYPAQFPASIWGIAREYIDEWYAAEVGRLEFSPEDPLDCIPLASDPDASGAAFVVAGS
FT                   GPGWDAGTVVELEGGVHRYENVREYLRARLALVREA"
     atggatacgg agacgatggt cgaggagttg caggagctca ttgcggacct ggcgcgcgag        60
     cgggtgcgag cgggggagga ggacggggac ggtctcgaga tccgcctcga cctcgatcca       120
     gacggccagg tgatcgccac cgccgcaccg gcaccacccg cgaccgaggc cgagatcgcg       180
     caggccgagg ccgccctcgg gcggccctat ccaccggaat tgcgcgcact gctcggagtc       240
     gccaacggat tccccggcta cttctacggc gacacgctgc tcggtacgtc cggggtgggc       300
     accgccgggg tggcgggata ccccgcgcag ttcccggcat cgatctgggg aatcgcgcgg       360
     gagtacatcg acgagtggta cgcggcggag gttgggcgtc tcgagttcag tcccgaggac       420
     ccgctcgact gcatcccact ggcatcggac cccgacgcct caggggcggc gttcgtggtg       480
     gccggcagcg gacccggatg ggacgcgggc accgtcgtcg agctcgaggg cggagtccac       540
     cggtacgaga acgtgcgcga gtacctccgc gcccgactgg cgctggtccg agaggcctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page