(data stored in ACNUC1104 zone)

EMBL: CP001966.PE61

CP001966.PE61        Location/Qualifiers
FT   CDS_pept        complement(62641..64212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0061"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; multi antimicrobial extrusion
FT                   protein MatE; KEGG: mpa:MAP0963c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76715"
FT                   /db_xref="GOA:D5UPU7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADG76715.1"
FT                   /translation="MPDYSIATEVSGSESGTAQGRASSGRIARAFGVQMVARVVGLMAS
FT                   IVTMALTSRHLGLTSYGHLQAAIAFVGLWTSFTELGIGAVIVRRVTSGLADLSQLVRVS
FT                   VGLSIAYCVPLGALTLFMGWGIYSSQGSEVVAMIAIVAVSLILTTLSSCFQPIFMTNVQ
FT                   FGAVAASDVVGRVLSLAGTVWLISIDAPLVWFAAVQIVPPLVALVIQAIAARRLVEISP
FT                   VFSVGESWHLIRESLPQTGVLIIAALYWRSDAFLLSILSTPQQLGAYSLAYGIAFNATV
FT                   ISATYLASALSTMTNLWATDRDEFARFTVRSMQAMLFLGTPMVAIGLTLAPGIIHLISD
FT                   SEFVEIGSVALGLLFIAVALRFVNAVLSQALFAAHDQVFLLRLNVVNLIGNIVLNVILI
FT                   PPFGAAGAGIALIASETVGLLVATWRLTRRSPYRTPWRFCLHLLVPLGATVGVCLALDD
FT                   VLPVLVTAMIAGVVFLAVNLALGPVHASAIRELLARGGEPDARDDESSKAPPTSSEPTS
FT                   SEGNTR"
     gtgcccgact attcgattgc aacagaggtt agcggtagtg agtccggtac cgcgcaggga        60
     cgggcctcat cgggccgtat cgcccgcgcc ttcggtgtgc agatggtggc acgcgtcgtc       120
     gggctgatgg cttcgatcgt cacgatggca ctcaccagtc gccatctcgg tctcacctcg       180
     tacggccacc tccaggcggc gatcgctttc gtcgggttgt ggaccagctt caccgagttg       240
     ggcatcggcg ccgtgatcgt gcggcgggtg acgtcgggac tggcggacct gtcgcagctg       300
     gtccgggtga gcgtgggact gtccatcgcc tactgcgtcc cgctcggggc gctgaccctg       360
     ttcatggggt gggggatcta ctccagccag ggcagcgagg tggtggcgat gatcgccatc       420
     gtcgccgtca gcctgatcct caccactctg agcagctgtt ttcaaccgat cttcatgacc       480
     aacgtgcagt tcggcgcggt ggcggcgtcg gacgtggtcg ggcgcgtgct ctcgctggcc       540
     ggaaccgtct ggttgatctc gatcgacgca ccgctcgtgt ggttcgccgc tgtgcagatc       600
     gtgccgccgc tggtggccct cgtgatccag gcgatcgcgg cacgccggct ggtggagatc       660
     tcccccgtgt tctccgtcgg cgagagctgg catctgatcc gggagagcct gccgcagacc       720
     ggcgtgttga tcatcgccgc gttgtactgg cgctcggacg ccttcctgct cagtattctc       780
     agcacgccgc agcaactcgg tgcctacagc ctggcctacg gcatcgcctt caacgccacg       840
     gtgatctcgg cgacgtacct cgcatcggcg ctgtcgacca tgaccaacct gtgggctacc       900
     gaccgcgacg agttcgcgcg attcacggtg cgcagcatgc aggcgatgct cttcctcggt       960
     actccgatgg tggcgatcgg cctgactctc gcacccggga tcatccacct gatcagcgac      1020
     tccgagttcg tcgagatcgg gagcgtggca ctgggtctgc tgttcatcgc cgtggcgctg      1080
     cgcttcgtca acgccgtgct cagtcaggcg ctgttcgcgg cccacgacca ggtcttcctc      1140
     ctgcgcctga acgtggtgaa cctgatcggc aacatcgtgc tgaacgtcat cctcatccca      1200
     cccttcggcg cggcgggcgc aggtatcgcg ctgatcgcca gcgaaaccgt cgggctcctg      1260
     gtcgcgacgt ggcgactgac ccgtcgcagc ccctaccgca ccccctggcg gttctgcctg      1320
     cacctgctcg tcccgctcgg cgcgacggtc ggcgtatgcc tggcactcga cgacgttctg      1380
     ccggtgctcg tcacggcgat gatcgcgggc gtggtcttcc tggcggtgaa tctggcactc      1440
     gggcccgtgc acgcttccgc cattcgcgag ctgctggcgc ggggtggcga acccgacgcc      1500
     cgtgacgacg aatccagcaa ggccccgccg acctcatcag agccgacctc gtcagaaggg      1560
     aacacccggt ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page