(data stored in ACNUC1104 zone)

EMBL: CP001966.PE610

CP001966.PE610       Location/Qualifiers
FT   CDS_pept        646239..647093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0626"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rop:ROP_17460
FT                   putative non-heme haloperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77264"
FT                   /db_xref="GOA:D5USX7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77264.1"
FT                   /translation="MTRACGFAVGADGTEIFYIDYGTAYADTVDPTKPAYLLIHGWSAS
FT                   GDSWGLPLVDELTAAGHRVVTVDNRGHGRSSVPSSFTTEDFAGDVRAVRELLGLDEVYL
FT                   VGWSYGGLIIADHLTVYGTDGVLGVGLIGAITSIGGTKEGQFPAGVTGPAMNGALPAAL
FT                   SAKPGTAIPALASVRMLPKGFDQETLGPVAQRVFGHSLSTPPAVRGGLFRRTVDHDADL
FT                   ATWTFPVLIQHGRDDEVVAPVTAEHHAVVLPHSTLSWWDGGGHAPFIVDPARCARELLD
FT                   LRG"
     gtgactcgtg catgtggatt cgccgtcggg gccgacggca cggagatctt ctacatcgac        60
     tacggcaccg cgtacgcgga caccgtcgac ccgacgaaac cggcgtatct gctgatccac       120
     ggttggtcgg cgagcgggga ctcctggggg ttgccgctgg tcgacgagct gaccgcggca       180
     ggacaccggg tggtcaccgt cgacaaccgc ggccacgggc gcagttcggt gccctcgtct       240
     ttcacgaccg aggacttcgc cggcgacgtc agggccgtgc gcgagttgct gggcctcgat       300
     gaggtgtatc tggtgggctg gtcgtacggc ggcctgatca tcgccgacca cctcaccgtg       360
     tacggcaccg acggggtgct cggtgtcggc ctgatcggtg cgatcacctc gatcggcgga       420
     acgaaagagg gacagttccc cgcaggcgtg accggccccg cgatgaacgg cgctctgccc       480
     gctgcgctgt cggcgaaacc cggcaccgcg atcccggccc tggcgagcgt ccggatgctg       540
     ccgaagggct tcgaccagga gactctcggc cccgtcgccc agcgtgtctt cggccactcc       600
     ttgtccaccc cgcctgcggt gcgcggcggg ctgttccggc gcaccgtcga ccatgatgcc       660
     gacctcgcga catggacctt cccggtattg atccagcacg gacgcgacga tgaggtggtt       720
     gccccggtca ctgccgagca ccacgcggtg gtgctaccgc attccacgct gtcgtggtgg       780
     gacggcggag gtcacgcgcc cttcatcgtg gacccggccc gctgcgcccg cgaactcctc       840
     gatctgcggg gttaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page