(data stored in ACNUC1104 zone)

EMBL: CP001966.PE613

CP001966.PE613       Location/Qualifiers
FT   CDS_pept        complement(648883..650382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0629"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10372 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77267"
FT                   /db_xref="GOA:D5USY0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USY0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77267.1"
FT                   /translation="MQLPSNPMTDNLRRNRPADGVLIAVLCLGGLLASLMQSLVVPIVG
FT                   QLPHLLDTTTDNAAWVITATLLASSVAMPIAGRLGDMYGKRLVLLTSLLSLITGSLICA
FT                   LSHTLLLTVVGRSFQGFAMGLVPVGISLMRDELHARKIPGAVALMSAMLGVGGAIGIPF
FT                   GAYISEHFDYHTLFWFSLALGVVTLGLVFVVVPESPNRHPGTFDVVGTVGLTVGLVSVL
FT                   LSITKGQSWGWTSAATLGCAIGGALVLIAWGFWETRTRDSLVDLRISARRPILLTNLAS
FT                   IMVGFAMFSLMLTMPQLLQIPEATGYGLGQTMLNAGLWMVPGGLVMMALSPVSALLTKR
FT                   IGARLTLAIGATMSAIGYFALLGLTDATWKMSIGSMIVFGGVGVAYSAMPALIMANVPD
FT                   TESAAANGLNSLMRSVGTAISSAVMATILTRSTITLLAGTPREVTLPAEDAFTSGFVIA
FT                   GVVAAVAAVVALAIPRATKGGETTSAAPEDREIQEAGARTA"
     atgcaactac cgtcgaatcc catgacagac aacctccgca ggaaccgtcc cgcggacggc        60
     gtcctgatcg ccgtcctctg cctcggcggc ctcctcgcct cgctcatgca atcgctggtg       120
     gtgccgatcg tcggccaact gccgcaccta ctggacacca ccaccgataa cgccgcgtgg       180
     gtgatcaccg ccacgctgct cgcctcgtcg gtggcgatgc ccatcgccgg ccggctcggc       240
     gatatgtacg gcaagcgact ggtgctgctc accagcctgc tcagcctgat cacgggctcg       300
     ctgatctgcg cgctctcgca cacgctgctg ctcaccgtgg tcggccgctc cttccagggg       360
     ttcgcgatgg gcctggtgcc cgtgggcatc tcgctcatgc gcgatgagct gcacgcccgc       420
     aagatcccgg gcgccgtggc actcatgtcg gccatgctcg gcgtgggcgg tgcgatcgga       480
     atcccgttcg gcgcctatat ctccgagcat ttcgactacc acacgttgtt ctggttctcc       540
     ctcgccctcg gcgtggtcac tctgggcctg gtgttcgtgg tggtaccgga atcaccgaac       600
     cgccaccccg gcacgttcga cgtggtcggc accgtcggcc tcaccgtcgg cctggtgagc       660
     gtgctgctct cgatcaccaa gggccagagc tggggctgga cctcggccgc cacactgggc       720
     tgtgccatcg gtggtgctct ggtactgatc gcctggggat tctgggagac tcgtacccgg       780
     gattcccttg tggacctccg gatctcggcc cgccgcccga tcctgctgac caacctggca       840
     tcgatcatgg tgggcttcgc gatgttctcg ctgatgctga ccatgccgca gctactccag       900
     attcccgagg ccaccggtta cggtctgggc cagacgatgc tcaacgcggg cctgtggatg       960
     gtgcccggcg gtctggtgat gatggccctc tccccggttt ccgcactgct caccaagcgg      1020
     atcggcgcac ggctgaccct cgcgatcggc gccaccatgt cggcgatcgg ctatttcgcc      1080
     ctgctcggcc tcaccgatgc gacatggaag atgtcgatcg gctcgatgat cgtgttcggc      1140
     ggtgtgggag tagcctattc ggcgatgccg gcactgatca tggcgaacgt tccggacacc      1200
     gagtcggcgg cggccaacgg cctcaactcg ctgatgcgct cggtgggcac cgcaatcagc      1260
     tcggccgtca tggccacgat cctgacccgt tccaccatca ccctgctggc cggcaccccg      1320
     cgcgaggtga cgctgcccgc cgaggacgcc ttcacctccg gcttcgtgat cgccggcgta      1380
     gtggccgcgg tggccgccgt ggtggccctg gcgatcccgc gcgccaccaa gggcggcgaa      1440
     actacttctg ctgctccgga agatcgggaa attcaggaag caggtgctcg aacggcttga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page