(data stored in ACNUC1104 zone)

EMBL: CP001966.PE62

CP001966.PE62        Location/Qualifiers
FT   CDS_pept        64248..65309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0062"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fre:Franean1_0751 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76716"
FT                   /db_xref="GOA:D5UPU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76716.1"
FT                   /translation="MRVTVPLAGGLSEQDWARRHAAGEVPDRSPYGLHRLDRHDMSVRF
FT                   ASADFGAGRVGRAAARVARSVRHRTGGYEFVEAFTSGGRIGEADAVLAYDERTAVPALL
FT                   TGRTPVAAGIGWLNRRAVAGGVHGALAARALPRAGAVWAQCSAVLPVIGAEWGVPASRL
FT                   QFVPLGIDTEFYGEQPLPETPGLVMSAGEDRFRDHATLIGAVAAVRRNRPETRLELASA
FT                   LPFDAPDGLVTVHTERLNGRIRELYRRASVVAVALHPTVTGSGLTVVLEAMASGRPIVV
FT                   TDNPGVDDYVEHGVTGLTVPAGDCAAMAGAIESLLSDDGMRIEMGRAAAKRAREQFTSA
FT                   IMVDHLARMLRRM"
     gtgcgggtga cggtgccgct ggccgggggt ctgtcggagc aggactgggc ccgtcgtcac        60
     gccgcgggag aggtcccgga tcggtcaccg tacggcctcc atcggctgga ccgacacgat       120
     atgagcgtgc ggttcgcatc ggcggacttc ggtgccggcc gggtcggccg cgcggccgca       180
     cgggtggctc gttccgtgcg tcaccgcacc ggaggctacg agttcgtcga ggccttcacg       240
     tcgggcgggc gcatcggaga agcggatgcc gtcctcgcct acgacgaacg caccgcggta       300
     cccgccctgc tgaccggccg cacccccgtc gccgcaggga tcggatggtt gaatcgccgt       360
     gccgtggcgg gaggtgtaca cggagcgctc gccgcgcgtg cgctgccgcg ggcgggtgcg       420
     gtgtgggcgc aatgttcggc ggtgctgccc gtgatcggcg ccgaatgggg tgtgcccgcg       480
     tcccggctgc aattcgttcc gctgggcatc gataccgagt tctacggtga gcagcccctg       540
     cccgagaccc ccggactggt gatgagcgcg ggtgaggacc ggttccgcga tcacgcgact       600
     ctgatcggtg ccgtcgccgc cgtacgccgg aaccgccccg agactcgcct ggaactggcg       660
     tccgcgttgc ccttcgacgc gccggacggg ctcgtcaccg tgcataccga acggctcaac       720
     gggcgcatcc gtgaactgta ccgccgcgcg agcgtcgtgg cggtcgcgct gcatcccacg       780
     gtgaccgggt ccggactgac cgtggtgctg gaagcgatgg ccagcggacg cccgatcgtg       840
     gtgacggata accccggcgt cgacgactac gtcgagcacg gcgtcaccgg cctcacggtt       900
     ccggccggcg actgcgccgc gatggccggg gcgatcgagt cgctgctcag cgacgacggt       960
     atgcggatcg agatggggcg agcggcggcc aagcgcgccc gcgagcaatt cacctcggcg      1020
     atcatggtcg atcacctcgc gcggatgttg cgtcggatgt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page