(data stored in ACNUC1104 zone)

EMBL: CP001966.PE65

CP001966.PE65        Location/Qualifiers
FT   CDS_pept        67342..68091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0065"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   ace:Acel_1928 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76719"
FT                   /db_xref="GOA:D5UPV1"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV1"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADG76719.1"
FT                   /translation="MTAATQDRPGAVRDHGAAFENESRAPSGRRRVLLRRWLTLILFVV
FT                   VAVVGAMIGSKTTTQQYETSGTVLVIPPGAGSPVPRDNPFYRINDTAQFANVLASIALG
FT                   PEGRAVVAKAGASPEYAVRGFMGATEQSTKLSAQITLSVRAPNKWVAREAAMGLIALMR
FT                   ERLVSLQRDAGLRDRTYADLRVVVEPDPGVPVFGNAFRAALGYAIAAMLGVAAILALHA
FT                   SRADTRARRTAGGNGSLRDAVHERTAA"
     gtgaccgccg cgacgcagga ccggcccggc gcggtccgtg atcacggcgc tgccttcgag        60
     aacgagagca gagcgccgtc ggggcgccgt cgggtactgc tccgcaggtg gctgacgttg       120
     atcctgttcg tcgtcgtcgc agtcgtcggc gcgatgatcg gctcgaagac caccacccag       180
     cagtacgaga cgtcgggcac ggtgctcgtg atcccgccgg gcgccggcag cccagtgccg       240
     cgggacaatc cgttctaccg gatcaacgac accgcgcagt tcgccaatgt gctcgcgagc       300
     atcgctctcg ggcctgaagg ccgggccgtc gtcgcgaaag ccggtgcctc cccggaatac       360
     gccgtgcgcg gcttcatggg agcgacggag cagagtacga agttgtccgc gcagatcacc       420
     ctgtcggtgc gagcgccgaa caaatgggta gcgcgtgagg cggccatggg cctgatcgcg       480
     ctgatgcggg aacgactggt ctcgttgcag cgtgatgctg ggctacgcga ccgcacgtat       540
     gccgatctcc gcgtcgtcgt ggaaccggac cccggagttc ccgtcttcgg gaacgctttt       600
     cgtgcggcgc tggggtatgc gattgcggcg atgctgggcg ttgccgcgat tctcgctttg       660
     catgcctcgc gcgcggatac gcgcgcgcga cgcaccgctg gcggaaatgg ctcactgcgg       720
     gatgccgtgc acgaacggac ggccgcgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page