(data stored in ACNUC1104 zone)

EMBL: CP001966.PE67

CP001966.PE67        Location/Qualifiers
FT   CDS_pept        69641..70882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0067"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase domain
FT                   protein; Methyltransferase type 12; Methyltransferase type
FT                   11; KEGG: msm:MSMEG_5980 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76721"
FT                   /db_xref="GOA:D5UPV3"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV3"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADG76721.1"
FT                   /translation="MTCSVCGSDRLRSVVDLGATPPCEKFLQADELDLPEPTYPLHLRL
FT                   CEDCLLLQIPALILPEETFSEYAYFSSFSDSWVAHAKRFVDEAADRLELGPDSFLVEVA
FT                   SNDGYLLQHAVARGIPCLGIEPSVNVGAAARDKGVPTLTAFLNEETAAQVVAEHGRADL
FT                   IAANNVYAHVPDVLGFTRSLRTLLADDGWLSIEVHHALNLVQLGQFDTIYHEHFSYYTV
FT                   YSAQRALATAGLDVVDVELIPTHGGSIRVWARPVEAGATPSPRVAEVLALEAEAGLHEV
FT                   SGYTGLQARADATRQDLLRFLLDRKAEGKRVVGYGAPGKGNTLLNYCGVRADLLEYTVD
FT                   RNPYKHGRYTPGSRIPIHAPERIDEDRPDVIVVLPWNLEAEITAQLAHVAEWGAELVYP
FT                   LPTLHSADLPARVG"
     atgacctgca gtgtgtgtgg ttccgatcgc ctgcgcagtg tggtggacct cggtgccacc        60
     ccgccgtgcg agaagttcct ccaggccgat gagctggacc tgccggaacc gacctaccca       120
     ttgcacctac ggttgtgcga ggactgcctg ctgttgcaga tcccggcgtt gatcctgccg       180
     gaggagacgt tctccgagta cgcctacttc tcctcattca gcgacagctg ggtggcgcac       240
     gcgaagcgct tcgtcgatga ggcggccgac cggctcgaac tcggccccga cagcttcctg       300
     gtggaggtgg ccagcaacga cggctacctg ctgcagcacg ccgtcgcccg cggcatcccc       360
     tgcctgggca tcgagccctc ggtgaacgtc ggcgcggcgg cccgcgacaa gggcgtgccc       420
     acgctcaccg ccttcctcaa cgaggagacc gctgctcagg tggtggccga acacggcaga       480
     gccgatctga tcgccgccaa caacgtctac gcacacgttc ccgatgtgct cggcttcacc       540
     cgctcgctgc ggaccctgct cgccgacgac ggttggctca gcatcgaggt gcaccacgcg       600
     ctgaacctcg tgcagctggg ccagttcgac accatctacc acgagcactt cagctactac       660
     accgtgtact cggcgcagcg cgccctggcc accgccgggc tcgacgtggt cgacgtggag       720
     ctcatcccca cccacggcgg atccatccgg gtgtgggccc gccccgtcga ggccggcgcc       780
     accccgtcgc cgcgcgtcgc cgaggtgctc gcgctcgagg ccgaggccgg gctgcacgaa       840
     gtctccggct acaccggcct gcaggcgcgc gccgacgcca cccggcagga cctgctgcgc       900
     ttcctgctcg accgcaaggc cgagggcaag cgcgtggtgg gctacggcgc tcccggcaag       960
     ggcaacaccc tgctcaacta ctgcggcgtg cgcgccgacc tgctcgagta caccgtcgac      1020
     cggaacccgt acaagcacgg ccggtacacc ccgggcagcc gcatcccgat ccacgcgccg      1080
     gagcggatcg acgaggaccg gccggacgtg atcgtcgtcc tgccgtggaa cctcgaagcc      1140
     gagatcaccg cccagctcgc tcacgtcgcc gaatggggcg ccgaactcgt ctatcccctt      1200
     cccaccctgc attccgccga cctgcccgcg cgcgtcggct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page