(data stored in ACNUC1104 zone)

EMBL: CP001966.PE68

CP001966.PE68        Location/Qualifiers
FT   CDS_pept        70896..71678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0068"
FT                   /product="Glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="KEGG: sco:SCO0393 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76722"
FT                   /db_xref="GOA:D5UPV4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV4"
FT                   /inference="protein motif:PRIAM:2.7.7.33"
FT                   /protein_id="ADG76722.1"
FT                   /translation="MKVVLFCGGYGMRMRGGADDTVPKPMQMVGPRPLIWHVMRYYAHF
FT                   GHTEFILCLGYGAGHIKDYFLNYRETASNDFVIRGGEVELLSTDLSDWTINFVDTGLES
FT                   AIGERLRRARPFLDGDEYFLANYADVLSDAPMNTIIDKVKAEGAAASMLLVPPQSSFHC
FT                   VDVDGDDKVTGITPVSEFPIWENGGYFVLTQEVFDHLPEGGDLVADACGALLKENRLIG
FT                   YRHRGFWKPADTFKERAELDAGYAQGHRPWMLWENGHS"
     atgaaggtcg ttctgttctg cggcgggtac ggcatgcgaa tgcggggcgg tgccgacgat        60
     acggtgccca agccgatgca aatggtcggt ccgcggcccc tgatctggca cgtgatgcgc       120
     tactacgcgc acttcggcca caccgagttc atcctgtgcc tgggctacgg cgcagggcac       180
     atcaaggact acttcctcaa ctaccgcgag acggcgtcga acgacttcgt catccgcggc       240
     ggcgaggtgg agttgctgtc caccgacctg tcggactgga ccatcaactt cgtcgacacc       300
     ggcctcgaat cggcgatcgg cgaacgtctg cggcgcgcgc ggccgttcct cgacggcgac       360
     gagtacttcc tcgcgaacta cgccgacgtc ctcagcgacg ccccgatgaa caccatcatc       420
     gacaaggtca aggccgaggg cgccgcggca tcgatgctgt tggtgccgcc gcagtcctcc       480
     ttccactgcg tcgatgtgga cggtgacgac aaggtcaccg gtatcacccc ggtctccgag       540
     ttcccgatct gggagaacgg cggctacttc gtgctcaccc aggaagtttt cgaccatctc       600
     ccggagggcg gcgatctggt ggccgacgcg tgcggagcgc tgctgaagga gaaccggctg       660
     atcggctacc gccatcgcgg cttctggaaa ccggcggaca ccttcaagga gcgcgccgag       720
     ctcgacgccg gctacgccca gggacatcgc ccgtggatgc tgtgggagaa cggccactcg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page