(data stored in ACNUC1104 zone)

EMBL: CP001966.PE69

CP001966.PE69        Location/Qualifiers
FT   CDS_pept        71675..72328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0069"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: msm:MSMEG_5978
FT                   GlcNAc-PI de-N-acetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76723"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV5"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADG76723.1"
FT                   /translation="MIGLSPGAVREVAVLGAHCDDIAIGMGGTLLQIAEANPGVRVRAF
FT                   VGSGGGTPREAEERAALAAFAPGADLRITVLDLPDGRSPAYWEREKQALSEFRRSTDPD
FT                   VVFAPHRGDAHQDHRQLAEMVPTEFRDHLTLGYEILKWETDTPRPTVFNPLTVYAAMTK
FT                   ARLLTECYPSQTAHDWFDDESFLGLARLRGIQCRAPYAEGFMLEKAIVEFGGFR"
     gtgatcggac tctcgcccgg ggcggtgcgc gaggtcgcgg tgctcggtgc ccactgcgac        60
     gatatcgcga tcggtatggg cggtacgctg ctgcagatcg ccgaggcgaa tccgggtgtc       120
     cgcgtgcgcg ctttcgtcgg tagcggcggc gggaccccgc gcgaggccga ggaacgcgcc       180
     gcgctggcgg cgttcgctcc cggcgccgac ctgcgaatca cggtcttgga tctgccggac       240
     ggtaggtcgc ccgcgtactg ggagcgggag aagcaggcgc tcagcgagtt ccgtcgttcg       300
     accgacccgg atgtggtgtt cgcgccgcac cgcggcgatg cgcaccagga tcatcggcag       360
     ctggccgaga tggtgccgac ggagttccgc gaccatctga cgctcgggta cgagatcctc       420
     aagtgggaga ccgatacacc gcgtccgacg gtgttcaatc cgctcaccgt gtacgccgcg       480
     atgaccaaag cgcggctgct caccgagtgc tacccgtcgc agacggcgca cgactggttc       540
     gatgacgagt ccttcctcgg cctggcccga ctgcgcggga tccaatgtcg cgcaccctat       600
     gccgagggat tcatgctgga gaaggcgatc gtggagttcg gaggatttcg atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page