(data stored in ACNUC1104 zone)

EMBL: CP001966.PE71

CP001966.PE71        Location/Qualifiers
FT   CDS_pept        73344..75797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0071"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; C-
FT                   methyltransferase; KEGG: rha:RHA1_ro05728
FT                   glutamate-1-semialdehyde 2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76725"
FT                   /db_xref="GOA:D5UPV7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV7"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADG76725.1"
FT                   /translation="MACRGCGSGDLHRVLDLGAVPAADHFPPAESPVTQEESAHPLAMD
FT                   LCGACGLAQLAADDTVTDEPRGVEPQALKDQAADAVARAASAGWLNGKTVREFGSPHGG
FT                   TWLPLLAERGLQPTEGPADVVVDCFGVMHEPDQKAAFARRAAALAPGGVLLLQYHALGA
FT                   IVAGEQWNALRHGHFAYYSLHALSGLLAGAGLSVAGAWEFDLYGGTVMLAVVEGSVAPD
FT                   DTVFRLLDEEERAGLRDPAVVGTLGRAALRQAAALRAWAHDETAAGRRPAAYGAASRAV
FT                   ALFALAGLNRAVLSAVADASPGKQGRRMPGTDIPIVAPEVVAAGTGPVLLTLPDLRDEL
FT                   VAGYPALSDRLVVDPSTVVTSPVALEPDDGPPPRDFTESNRLQARLHQLVPGGAHTYAR
FT                   ASDQYPENMAPILTGGLGARVQDVDGNEYVEYGMGLRAVTLGHAHPRVVAAVTDAIAHG
FT                   TNFSRPTALEVDAAEDFLALVPGADMVKFAKNGSDATTAAVRLARAATGRDLVAACDHP
FT                   FFSVDDWFIGTTAMNAGIPAEVPAKTLRFQYNDPGSLQRLFDENPGRIACVFLEAATAT
FT                   AEPVDGFLERVRTLCDRNGALLVFDEMITGFRWSEHGAQGLYGVIPDLSCWGKAMGNGL
FT                   PMAALAGRREYMELGGLNTDRDRVFLLSTTHGPETAGLAAFRAVVAEYAESDPIGAMEA
FT                   AGRRLERAATEVIAGAGLADYVQVIGRPSCQVFVTRDAEGAPSQAYRTLFLQGLLENGV
FT                   LAQSLVNSAAHTEADVDHTVDAIEEALVAYGRAVVDGTVEGHLRGRPVAPALRRSAAPR
FT                   RLPDA"
     atggcatgcc ggggctgcgg gagcggcgat cttcaccggg tgctcgatct gggcgcggtg        60
     cccgccgccg accactttcc gcccgcggag tcccctgtca cacaggagga atcggcgcac       120
     ccgttggcga tggatctgtg cggagcttgc ggcctagcgc agctcgccgc cgacgacacg       180
     gtgaccgacg agccgcgcgg agtggaaccg caggctctca aagatcaggc cgccgatgcc       240
     gtggcccgcg ctgcgtccgc cggctggctc aatggaaaga cggtgcgtga gttcggcagt       300
     ccgcacggtg gcacctggct gccgctgctc gccgagcgcg gtcttcagcc caccgaaggc       360
     cccgcggatg tggtggtgga ctgtttcggc gtgatgcacg agcccgatca gaaggcggcg       420
     ttcgcgcgcc gcgccgccgc actggcaccg ggtggggtgc tcctgctcca ataccacgca       480
     ttgggcgcca tcgtcgccgg ggagcaatgg aacgcgctgc ggcacgggca cttcgcgtac       540
     tactccctgc atgcgctgag cgggctcctg gcaggtgccg gtctcagcgt cgccggtgcc       600
     tgggagttcg atctgtatgg cgggaccgtg atgctcgccg tcgttgaagg cagtgtggca       660
     ccggacgaca ccgtgttccg cctgctcgac gaggaggagc gcgccgggct gcgtgacccc       720
     gcggtggtgg gcaccctcgg ccgggcagcg ctccggcagg cggccgcgct ccgggcctgg       780
     gcgcacgacg agacggccgc cggccggcgg ccggccgcct acggagccgc ctcgcgggcg       840
     gtggcgttgt tcgcgctcgc cggtctgaac cgtgccgtgc tgtccgccgt cgccgatgcc       900
     agtcccggta aacagggccg tcgcatgccc ggcaccgaca tccccatcgt cgcgcccgag       960
     gtcgtggcgg caggcaccgg cccggtgttg ctcaccctgc ccgacctgcg cgacgagctg      1020
     gtcgcgggct atccggcact ctccgaccga ctggtggtcg acccgagcac ggtcgtcaca      1080
     tcaccggtcg cgctcgagcc cgacgacggc ccgcccccgc gcgatttcac cgaatcgaac      1140
     cgactacagg cgcgtctgca ccagctcgtg cccggcggcg cccacaccta cgcgcgcgcc      1200
     tccgaccagt accccgagaa catggcaccg atcctgaccg gcggcctcgg tgcgcgcgtg      1260
     caggacgtcg acggtaacga gtacgtcgaa tacggaatgg ggctgcgggc cgtcaccctg      1320
     ggccatgcgc atccgcgcgt cgtggccgcg gtcaccgacg cgatcgccca cggcaccaac      1380
     ttcagccgtc ccaccgcact ggaggtggac gccgccgagg acttcctcgc cctggtgccc      1440
     ggcgccgata tggtcaagtt cgccaagaac ggttccgatg ccacgaccgc cgcggtacgg      1500
     ctggcccggg ccgccaccgg gcgcgacctg gtggccgcgt gcgatcaccc gttcttctcc      1560
     gtcgacgact ggttcatcgg taccactgcc atgaacgcgg gcatccccgc cgaggtaccc      1620
     gcgaagactc tgcgattcca gtacaacgat cccggttccc tgcagcgcct gttcgacgag      1680
     aaccccggcc gcatcgcctg cgtcttcctg gaggcggcga ccgccacggc cgagcccgtg      1740
     gacggtttcc tcgaacgcgt ccggacgctg tgcgaccgga acggagccct gttggtcttc      1800
     gacgagatga tcaccggatt ccggtggtcc gagcacggtg cgcaggggct gtacggtgtg      1860
     attcccgatc tgtcctgttg gggtaaggcc atgggcaatg gattgcctat ggccgcgctc      1920
     gccggccggc gcgagtacat ggaactgggc gggctgaaca ccgatcgcga ccgcgtcttc      1980
     ctcctgtcca ccacgcacgg cccggaaacc gccggtctgg cggccttccg cgctgtggtc      2040
     gccgagtacg ccgagtccga tccgatcggc gccatggagg ccgccggccg ccggctcgag      2100
     cgggcggcca ccgaggtgat cgcgggggcc gggctcgccg actacgtcca ggtgatcgga      2160
     cggccttcgt gtcaggtgtt cgtcacccgc gacgccgagg gtgcaccgtc acaggcctat      2220
     cgcaccctgt tcctgcaggg attgctcgag aacggggtgc tggctcagtc cctggtgaac      2280
     tccgccgcgc acaccgaggc cgatgtcgat cacaccgtcg acgcgatcga ggaagccctc      2340
     gtcgcctacg gtcgggccgt cgtcgacggc accgtcgagg ggcatctgcg cgggcgtccg      2400
     gtggctcccg cgctgcgccg ctccgccgcc ccccgccgct tgcccgacgc ctga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page