(data stored in ACNUC1104 zone)

EMBL: CP001966.PE73

CP001966.PE73        Location/Qualifiers
FT   CDS_pept        76388..77113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa11270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76727"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76727.1"
FT                   /translation="MNATTDFHKPAVRRAAAVAATGALIVGLTGGIAAAEPDAQTTPTT
FT                   PASELLLEQKDFPGGYWVVPSPQQRLANELGADPLTLVASAKVNPPECKNVLTAAKNGG
FT                   GTDANTVAGVHDQDRKSLSESLVPKAADVDTLKVGLLKLCSDVTIEANDPKGGVVKVRA
FT                   KTKEVASDKQKATFEIVIDGTRTKGTDSFPVQQKVLFGVASLRGYTVAVQGTKLGGDPD
FT                   RGEFDSFFSKSVNKVKDAK"
     atgaacgcga cgactgactt ccacaagccc gctgtgcgcc gggcggcggc cgtggccgcc        60
     accggtgccc tgatcgtcgg tctcaccggc ggcatcgccg ccgccgagcc cgatgcgcag       120
     accacaccca ccacccccgc ttccgagctg ctgctcgagc agaaggactt cccgggcggc       180
     tactgggtgg tgccctcgcc gcagcagcgc ctcgccaacg agctcggggc cgatccgctg       240
     actctcgtgg cctcggccaa ggtgaacccg ccggagtgca agaacgtgct caccgcggcg       300
     aagaacggcg ggggcaccga cgccaacacc gtcgccggcg tgcacgatca ggaccgcaaa       360
     tcgctgagtg aatcgctggt tcccaaggcc gccgatgtgg acaccctcaa ggtgggtctg       420
     ctcaagctgt gctccgatgt caccatcgag gccaacgatc ccaagggcgg cgtcgtcaag       480
     gtgcgcgcga agacgaagga ggtggcctcg gacaagcaga aggccacctt cgagatcgtc       540
     atcgacggca cccggaccaa gggcaccgac tccttcccgg tgcagcagaa ggtgctcttc       600
     ggtgtcgcct cgctgcgcgg ctacaccgtg gccgtgcagg gcaccaagct cggcggcgat       660
     cccgatcggg gcgagttcga ctcgttcttc agcaagtcgg tgaacaaggt caaggacgcg       720
     aagtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page