(data stored in ACNUC1104 zone)

EMBL: CP001966.PE74

CP001966.PE74        Location/Qualifiers
FT   CDS_pept        77116..78957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0074"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mbt:JTY_0106 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76728"
FT                   /db_xref="GOA:D5UPW0"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW0"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG76728.1"
FT                   /translation="MAEAVAPERPSPTPSDRPGHTPRTGAVALGVGAAVALAVVLWLVT
FT                   SEGEIRYDINGDSYPGALTAYGASIGRLAGTVAAALTFGALGYAVFRTKPQDGGELGLR
FT                   GYVTQLHARRYAAVWAVVSAPMILLAASDSAGQDLVATYRVGGLFALVSASEAAKGWIV
FT                   SLICAVIVIIAMRNCLTWVAHLWILLPAGIGLLATVVTANEAQGPKHDYSTAALITIAL
FT                   AGALWLGGLWSSVRLPERPEKRWTAPAFATLVLANGAVLAVVYAPGSDLWVTWYGWLYI
FT                   ATAVLIAAAALAQYLRARAPAAGLLTASIGTALAASLLTPPPFLRKRFTVGEVFMGYDL
FT                   PDPPNALRLATLWRFDLNFVLIVAAFAVGYLLLVRRTTSWPWYRTACFLFGCFALLVLT
FT                   SSGVSTYSKAMFSVHMVSHMLMTSLVPVFLLLGAPITLLRDTLTGAPKRWLELFLESKS
FT                   FVVLMRPAVQLLMFALMLYGLYFTPLFDRIGRYHWGHLGINLALLFTGFLFYWRVFQID
FT                   PVPKELPFIGRIGMLLAMMPISMVFALIVMTMDGLVGSRLYYYLDLSWMTDLQRDQFVG
FT                   GVAAWAVDEAAIALVTLGLVLHWAWQNRGEDSEPELL"
     atggctgagg cggtcgcccc cgagcgcccg tcgccgactc cctcggaccg ccccggccat        60
     acgccgcgga ccggtgcggt ggcgctcggc gtcggggcgg cggtggcgct cgccgtcgtc       120
     ctctggctcg tgacgagcga gggcgagatc cgctacgaca tcaacggcga cagctacccc       180
     ggcgcgctca ccgcgtacgg cgcatcgatc ggccggctcg cgggcacggt cgccgcagcg       240
     ctgacattcg gcgccctcgg ctacgccgtg ttccggacca aaccgcaaga cggcggtgag       300
     ctcggcctgc ggggctacgt cacccagttg cacgcccgcc ggtacgccgc cgtctgggcg       360
     gtcgtctcgg cgccgatgat cctgctggcc gcgtccgaca gcgccggcca ggacttggtg       420
     gccacctacc gggtgggcgg gctgttcgcg ctggtctcgg cttccgaggc ggcgaagggc       480
     tggatcgtct ccctgatctg cgcggtgatc gtgatcatcg cgatgcgcaa ctgcctgacc       540
     tgggtggcgc acctgtggat cctgctcccg gcgggcatcg gcctgctcgc caccgtcgtg       600
     accgccaatg aggcgcaggg tcccaagcac gattattcga cggcggcact catcacgatc       660
     gcgctcgcgg gcgcactctg gctgggcggt ctgtggtcgt ccgtccggct ccccgaacgc       720
     cccgagaagc gatggaccgc acccgcgttc gcgacgctcg tgctcgcgaa cggtgccgtc       780
     ctcgcggtgg tctacgcgcc cggttcggac ctgtgggtca cctggtacgg ctggctgtac       840
     atcgccaccg ccgtgctcat cgcggcggct gccttggccc agtacctgcg cgctcgtgcg       900
     ccggcagccg ggctgctcac cgcctccatc ggcaccgcgc tggctgcctc gctgttgacc       960
     ccgccgccgt tcctgcgcaa gcgattcacc gtcggcgaag tattcatggg ctacgacctg      1020
     cccgatccgc cgaacgccct ccgcctggcc accctgtggc gcttcgacct caacttcgtg      1080
     ctgatcgtgg ccgcgttcgc cgtcgggtac ctgctgctgg tgcggcgcac cacgtcctgg      1140
     ccctggtacc gcaccgcatg cttcctgttc ggctgcttcg cgctgctcgt gctcaccagc      1200
     tcgggcgtga gcacctattc gaaggccatg ttcagtgtgc acatggtctc gcacatgctg      1260
     atgacctcgc tcgtccccgt gttcctgctg ctgggtgcgc cgatcacact gctgcgcgac      1320
     actctcaccg gggcgccgaa gcggtggctg gagctgttcc tggagtcgaa gtcgttcgtg      1380
     gtgctgatgc ggccagccgt ccagctcctg atgttcgcgc tcatgctcta cggcctgtac      1440
     ttcaccccgc tgttcgaccg gatcggccgt tatcactggg gccatctcgg catcaacctg      1500
     gcgctgttgt tcaccgggtt cctgttctac tggcgcgtct tccagatcga cccggtaccg      1560
     aaggagctgc ccttcatcgg tcgcatcggc atgctgctgg cgatgatgcc gatctcgatg      1620
     gtgttcgcgc tgatcgtgat gacgatggac ggcctggtcg gctcccgcct gtactactac      1680
     ctggacctgt cctggatgac ggatctccag cgcgaccagt tcgtgggcgg ggtcgccgcc      1740
     tgggcggtcg acgaggccgc gatcgcgctg gtgacgctcg gcctggtgct gcactgggcg      1800
     tggcagaacc gcggtgagga ttccgagccc gagctgctgt ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page