(data stored in ACNUC1104 zone)

EMBL: CP001966.PE76

CP001966.PE76        Location/Qualifiers
FT   CDS_pept        80455..82071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_4243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76730"
FT                   /db_xref="GOA:D5UPW2"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76730.1"
FT                   /translation="MHKLWIAIPLAALAFLDSMTLARSHSEAEDAAQYILNVTNGDDLF
FT                   HSNHLLYGPVNWVNFRLWEALGYAGDAVVPMQVLSVSASLVSVWLVYRIALRVGASLPL
FT                   SLAATGWVAFSFGFWVYSLEADTYLLPIPFLLWSVMLMLDVIAADASSRSRTFARLSGL
FT                   GAVAAMAALLHQQYVFLLPVIAITFVIVWRRSSERTSARLLFGLGVFLASSWLLIAVTY
FT                   CVVGRLAIGLSSPVDIVSWARGHASNGMWEAISAKTPLMMLVGFGRAVFAMNFLFRSPR
FT                   SSDLMSRVFAGKSLVEERHLAEHGINTVAFLAILLAMAAALAAMAWLLVRLVRRSARRD
FT                   GEEKFAAKTTFMIFAAVYLLVNVIVIMIWEPGNLEFWIAVMPALAIALAVLLSERTRAV
FT                   AASFVLVGALFVANLLGAVVPYSQTSNDYWAMQNGGFRGLVAEGDVIVTDCPYLCRGDL
FT                   ALLTDVPPIDASSDDVDELTAALGTPGTDVFVSSWTFDPPPQAEAPTGNGTVRKQLDER
FT                   RSQLVEVGRSGDQIIYRLERG"
     atgcacaagc tctggatcgc gattccgttg gccgcgttgg catttctgga ttccatgacc        60
     ctcgcccgta gtcacagcga ggcagaggac gccgcccaat acatcctgaa cgtcactaat       120
     ggtgacgacc tcttccattc gaaccacttg ttgtacgggc cggtgaactg ggtcaacttc       180
     cgactgtggg aggcgctcgg atacgccggc gacgcggtcg tcccgatgca ggtcctctcg       240
     gtcagcgcca gcctggtctc cgtatggctg gtctaccgga tcgcgctccg cgtcggggcg       300
     tccctcccgc tttccctcgc agcaaccggc tgggtcgcgt tctccttcgg attctgggtc       360
     tacagtctcg aggcggatac ctacctcctg cccatcccgt tcctcctgtg gtcggtcatg       420
     ctgatgctcg acgtgatcgc ggcggacgca tcatcgcgat ctcggacctt cgcgaggcta       480
     tcgggactgg gcgcggttgc cgcgatggcg gcactcctgc atcagcagta cgttttcctc       540
     cttccggtca tcgcgatcac cttcgtcata gtgtggcgcc gcagctccga aaggacgtcg       600
     gcacggctgc tgttcgggct cggagtcttc ctcgcgtcat cctggctcct gatcgccgtc       660
     acctattgcg tagtgggccg gcttgcgatc ggattgagct cgcccgtgga catcgtttcg       720
     tgggctcgag ggcatgcgag taacggtatg tgggaggcga tctctgcgaa gactccgctg       780
     atgatgctgg tcggattcgg cagagcggta ttcgcgatga acttcctgtt tcgctcgccc       840
     cgctcgtccg atctgatgtc cagggtgttt gcgggaaagt cgctcgtcga agagcgccac       900
     ctggccgagc acgggatcaa caccgtggcc ttccttgcga tcctgctcgc gatggctgcg       960
     gctttggctg ccatggcgtg gctgctggta cgcctcgtgc gacggtcagc acgacgcgat      1020
     ggagaagaga agttcgctgc gaaaacgact ttcatgatct tcgccgccgt ctacctgttg      1080
     gtcaacgtca tcgtgatcat gatctgggag ccgggcaatc tcgagttctg gatcgcggtc      1140
     atgccggcgc tcgctatcgc gctcgccgtt ctgctgtcgg agcggaccag ggcggtagca      1200
     gcgagcttcg ttctggtcgg cgcgctgttc gtcgcgaatc tgctcggcgc ggtggtgccg      1260
     tactcgcaga cgagtaacga ctattgggcg atgcagaacg gagggttccg cgggctcgtg      1320
     gcggagggcg acgtgatcgt caccgactgc ccgtacctct gccgggggga cctcgccttg      1380
     ctcaccgatg tgccgccgat cgatgcatca tcggacgatg tggacgaatt gaccgcggcg      1440
     ctcggcacac ccggcacgga cgtgttcgtg tcctcgtgga ctttcgatcc gcctccgcaa      1500
     gcggaggcgc cgacggggaa cggtaccgtg cgtaaacagc tggacgagcg cagatcgcag      1560
     ctagtagagg tgggcagatc gggcgatcag atcatctatc gccttgagcg cggctag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page