(data stored in ACNUC1104 zone)

EMBL: CP001966.PE77

CP001966.PE77        Location/Qualifiers
FT   CDS_pept        82495..83697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0077"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   psa:PST_2494 endoglucanase precursor(endo-1,4-
FT                   beta-glucanase)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76731"
FT                   /db_xref="GOA:D5UPW3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW3"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADG76731.1"
FT                   /translation="MSRIFRRLIPLFVVIVLVVTSAALPTRRAVDDSTDGQRGINVTTL
FT                   LSQAITISGYPDLTDTGEPQASYDALAAVGHRLIRLPIDWNFLQPNLDKGDERFYSAYW
FT                   RAIKAEIGKIKKAGLKAVLDLHNGCEWTKPGSSEPPLVCGAGLSLDVTTGVWRTISEEF
FT                   KNEPAVVAYDLFNEPTKFTPPSIPNEAGKQAYSVYQAHVNAIVAALRAQGDRKEIWVES
FT                   LCCSIGLDINNTDPDGGWVVDPIKRIVYSLHMYPVGFDADAGLGEEFNPAKLDPNYEEP
FT                   KGKPWSNRGYVRGFLRRLDGFGSWCKRTGEQCSIGEVGWYSRGQAKDSVSRWNELGDEW
FT                   YNIADYYGLAVTYYGASSASVSPLWVYDAPGPSSWFPARGMTQKQSQASVIEKQSHLSK
FT                   P"
     atgagccgca tcttccgacg gctgatccct ctgttcgtcg tgatcgttct ggtggtgacg        60
     tccgccgcgc tacccacacg tcgcgcggtc gacgacagca ccgacgggca acgcggcatc       120
     aacgtcacca cacttctttc ccaggccatc acgatctccg gctaccccga tctgaccgat       180
     acgggtgagc cccaggctag ctacgatgcg ctggcggcgg tcgggcatag gctgatccgg       240
     ctcccgatcg attggaactt cctgcagccg aacctggata agggcgatga gagattctat       300
     tcggcctact ggcgtgcgat caaagctgag atcggaaaga tcaagaaggc cggcctcaaa       360
     gcggtactcg acctccacaa cggctgcgag tggactaagc cggggtcgtc ggagccgccg       420
     ctcgtctgcg gcgccggact gtcgctcgat gtgaccaccg gggtgtggcg cacaatttcc       480
     gaggagttca agaacgaacc ggccgtggtg gcctacgacc tgttcaacga gccgaccaag       540
     ttcaccccgc cgagcattcc gaacgaggcc ggtaagcagg cctattccgt ctatcaggcg       600
     cacgtgaacg ccatcgtcgc cgcgctgcgg gcgcaaggtg atcgcaagga gatctgggtc       660
     gaatcgctgt gctgttccat tgggctcgac atcaacaaca ccgatccgga cggaggctgg       720
     gtcgtcgatc cgatcaaacg catcgtctac tccctgcata tgtatccggt cggattcgat       780
     gccgatgccg gcctggggga ggagttcaac cctgcgaagt tggatccgaa ctacgaggag       840
     cccaaaggca agccgtggtc caaccgtggt tatgtgcgcg gattcctccg ccgcctcgac       900
     ggattcggct cgtggtgtaa acgcaccgga gagcaatgct cgatcgggga agtggggtgg       960
     tacagccggg gacaggctaa agacagcgtg tcacggtgga acgagctcgg cgatgagtgg      1020
     tacaacatcg ccgactacta cggtctggcc gtcacctact acggcgcgtc atccgccagc      1080
     gtgagcccct tgtgggtgta cgacgcgcct ggcccctcct cctggttccc cgcgcgcgga      1140
     atgacgcaga agcagtcgca ggcgtccgtg atcgagaagc agtcgcacct gtcgaagccc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page