(data stored in ACNUC1104 zone)

EMBL: CP001966.PE79

CP001966.PE79        Location/Qualifiers
FT   CDS_pept        complement(85384..86559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0079"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   xop:PXO_03301 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76733"
FT                   /db_xref="GOA:D5UPW5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW5"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADG76733.1"
FT                   /translation="MVFVVAVLVAAMSAIAIGPARAAVPVGDGQRGINVTTMEIQAVTI
FT                   FDHPTITNTGEPQSSYNYLASLGHKLIRLPISWNFLQPNLDTGNRTFHAAYWTAIKAEV
FT                   AKIKAAGLKTVLDLHNGCEWTKPKTTAPVKVCGAGLTLADTNDVWLQLSNQFKNEPSVV
FT                   AYDLFNEPVRFNHPTRSELQNAADQPYTSYKAAVNSIVAALRANNDSKKIWVESLCCHR
FT                   EHDLASTDPNGGWVIDPLNKIVYSQHMYPVSDSSKGEVFDMAKIDPNYEQPQGDFWADW
FT                   GYVRGFLSRLDRFAGWCDRSNVQCSIGEVGWYGDGQSPDSAALWNQLGDEWYNKANYHG
FT                   FAVTYYGASSTSPGSLWAYDSATPAWHPAPGFSRKQPQALILEKPSHLSRP"
     gtggttttcg ttgttgccgt gctggtcgcc gccatgtccg cgattgccat cgggcctgcg        60
     cgagcggcgg tccccgtcgg cgatgggcaa cgcgggatca acgtcaccac gatggagatt       120
     caggcggtga ccatatttga ccaccccacc atcaccaaca ccggcgaacc tcaatcgtcg       180
     tacaactatc tcgcgagcct cggccacaag ctgatccgcc tgcccatcag ttggaacttt       240
     ctccagccca atctcgacac cggcaaccga acatttcacg ccgcgtactg gaccgcgatc       300
     aaggcagaag ttgccaagat caaggcagca ggcctgaaaa ccgtgctcga cctccataac       360
     ggctgcgaat ggacgaagcc aaagacgaca gcacccgtga aagtctgcgg cgcgggactc       420
     acgctcgccg acacgaacga cgtatggctc caattgtcca atcaattcaa gaatgaaccc       480
     agcgtggtgg cgtacgacct cttcaacgaa ccggtgcgat tcaatcaccc gactcgcagc       540
     gaactccaga atgccgccga ccagccgtac acgtcgtaca aggcggccgt gaactcgatc       600
     gtcgccgctc tgcgtgccaa caacgacagc aagaagatct gggtcgaatc gctgtgctgc       660
     catagagaac acgacctcgc cagcaccgat cccaacggcg ggtgggtcat cgatccgctg       720
     aacaagatcg tgtactccca gcacatgtac cccgtgagcg atagctccaa gggcgaagtg       780
     ttcgatatgg ccaagatcga tcccaactac gaacaacctc aaggcgactt ctgggcggac       840
     tggggctacg tccgaggttt tctctcgcgg ctcgacaggt tcgccgggtg gtgcgatcgc       900
     agcaacgtcc agtgctccat cggcgaggtc ggctggtacg gcgacgggca gtcgccagac       960
     agcgccgcgt tgtggaacca gctcggcgat gagtggtaca acaaggccaa ttaccacgga      1020
     ttcgcggtga cgtactacgg agcgagttcg acatcgccgg gcagcctatg ggcctacgac      1080
     tccgccaccc ccgcatggca tcctgcaccc ggattcagcc gcaagcaacc gcaggcgctg      1140
     atcctggaga agccgtcaca tctctcacgg ccctag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page