(data stored in ACNUC1104 zone)

EMBL: CP001966.PE81

CP001966.PE81        Location/Qualifiers
FT   CDS_pept        complement(87293..89548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0081"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: mmi:MMAR_0264 cation transporter p-type ATPase
FT                   A CtpA; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76735"
FT                   /db_xref="GOA:D5UPW7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG76735.1"
FT                   /translation="MTDLQSAAPPASADESADATAEAQRTFLDVGGMTCAACVGRVERK
FT                   LNKLDGVRAVVNLATRTATVEHAPTVTVEQLTGTVEAAGYTAAPKSPNPRRAMLAEERE
FT                   RRDVLRRLVVSLVLFVPAADLSIVLAIIPSTRFPGWQWVLLALSLPVVTWGAWPLHKKA
FT                   WQGARHGAATMDTLVSVGIISATAWSVVTVLTPGRQRPDPHGLWNAIVQSDPIYLEVAM
FT                   GVTVFVLAGRYFEASARAKAASALRDLSTRGARDVSVLVRDGSELRIPIGELREDQVFV
FT                   VRPGETIATDGVVESGSAFVDNSAMTGESRPVPAGPGDRVVGGTVCQDGRLTVRAIAVG
FT                   EDTTFAAMLRLVEDAQATKARMQRLADRVSAVFVPCVFAIAALTFAGWMLFGGSIDDAV
FT                   KAAIAVLVIACPCALGLATPVAFMVASGRGAQLGVYVRGHQALEATESIDTVVFDKTGT
FT                   VTTGLLEVAAIAVADGFTEAQVLRLAGAVETASEHAVARAVVARAGADLPAVEDFRAVP
FT                   GLGATGTVDGRTVRVGNPRFVSPGVLAPAVDAAAEAGRTVAVVEVDGAVAAVMEIADTI
FT                   KPDARAAITRLHEAGITTVLLTGDNAAAAAKVAAAVGIDDIRSDVLPEGKVAEIRALQA
FT                   EGRRVAMVGDGVNDGPALAAADLGLAMGTGTDVAQGAADVVLMREELSAVPDALGLARA
FT                   TLKTIKTNLVWAFGYNVAAIPIAAAGLLNPLISAAAMSFSSFFVVWNSLRLRRFGSR"
     gtgacggatc tccaatcggc cgcgcctccc gcttccgcgg acgagtccgc ggacgccacg        60
     gctgaggcgc agcgcacctt cctcgatgtc ggcggcatga cctgcgcggc gtgcgtgggc       120
     cgggtggagc gcaagctcaa caagctcgac ggggtgcggg cggtagtgaa tctggccacc       180
     cgcaccgcaa cggtcgaaca tgcgccgacg gtcaccgtcg agcagctgac cggcaccgtc       240
     gaggcggcgg ggtacaccgc ggcaccgaag tccccgaacc cgcgccgcgc aatgctggcg       300
     gaggagcgcg agcggcgcga cgtgctgcgc cgcctcgtcg tctcactggt gctgttcgtg       360
     ccggccgccg atctgtcgat cgtgctcgcc atcatcccgt cgacccggtt ccccggctgg       420
     cagtgggtgc tgctcgcact gagcctgccc gtggtcacgt ggggcgcctg gccgctgcac       480
     aagaaggcct ggcagggcgc gcggcacggt gcggcgacga tggacaccct ggtctcggtg       540
     ggcatcatct ccgctaccgc gtggtcggtg gtcaccgtgc tcacacccgg ccggcagcgg       600
     cccgacccgc acggtctgtg gaacgcgatc gtgcaatccg acccgatcta cctcgaggtc       660
     gcgatgggcg tcacggtgtt cgtactcgcc ggccggtact tcgaggcctc cgcacgcgcc       720
     aaggcggctt cggcgctgcg cgacctctcg acccgcggcg cccgcgacgt gtccgtgctg       780
     gtgcgcgacg gttccgagct gcggatcccg atcggcgagc tgcgcgagga ccaggtgttc       840
     gtggttcggc ccggcgagac gatcgccacg gacggcgtgg tggagtccgg cagcgcgttc       900
     gtcgacaatt cggcgatgac gggcgagtcc cgcccggtcc cggccggacc gggcgaccga       960
     gtggtgggcg gcaccgtgtg ccaggacggc cgactgacgg tgcgcgccat cgccgtcggc      1020
     gaggacacca cgttcgcggc gatgctgcgt ctggtggagg acgcgcaggc cacgaaggcg      1080
     cggatgcagc gcctggccga tcgcgtctcg gcggtgttcg tgccgtgcgt gttcgccatc      1140
     gccgccctga ctttcgcggg ctggatgctg ttcggcgggt cgatcgacga tgccgtgaag      1200
     gccgcgatcg ccgtgctggt gatcgcctgt ccgtgcgccc tgggcctcgc gaccccggtg      1260
     gcgttcatgg tggcctcggg ccggggtgcg cagctcggcg tgtacgtacg cggccatcag      1320
     gcattggagg ccaccgagag catcgacacg gtggtcttcg ataagaccgg cacggtgacc      1380
     acgggcctgc tggaagtggc ggcgatcgcc gtggcggacg gattcaccga ggcccaggtg      1440
     ctgcgcctcg caggtgctgt cgagaccgcc tccgagcacg ccgtcgcgcg ggcggtcgtg      1500
     gcgcgggcgg gcgccgatct gcctgcggtg gaggatttcc gggccgtacc cggcctcggc      1560
     gccacgggta cggtggacgg gcggacggtg cgggtgggca atccgcggtt cgtctcgccc      1620
     ggtgtgctgg cgcccgcggt cgatgcggcg gccgaggcgg gtcgcaccgt ggccgtggtg      1680
     gaggtcgacg gggctgtggc cgccgtcatg gagatagccg acacgatcaa acccgatgcg      1740
     cgggcggcga tcacgcggct gcacgaggcc ggcatcacca ccgtcctcct caccggcgac      1800
     aatgccgccg cggccgcgaa agtggctgcg gccgtgggca tcgacgacat ccgttcggat      1860
     gtgctgcccg aggggaaggt ggcagagatc cgggcgctgc aggccgaggg ccgccgggtt      1920
     gccatggtgg gcgacggcgt gaacgacggt cccgcgctgg ccgcagcaga tctcgggttg      1980
     gcaatgggta ccggtaccga cgtggcccaa ggtgccgccg atgtggtgct gatgcgcgag      2040
     gagctgtccg ccgttcccga tgcgctcggc ctggcccgcg ccacactgaa gacgatcaag      2100
     acgaacctgg tgtgggcctt cggctacaac gtcgcggcga ttccgatcgc ggccgccgga      2160
     ctactgaatc ccctcatcag cgccgcggcg atgagcttca gctccttctt cgtggtgtgg      2220
     aacagcctgc gcctacgtcg attcggctcc cgctag                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page