(data stored in ACNUC1104 zone)

EMBL: CP001966.PE82

CP001966.PE82        Location/Qualifiers
FT   CDS_pept        complement(89785..90867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0082"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: ami:Amir_0226 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76736"
FT                   /db_xref="GOA:D5UPW8"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW8"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADG76736.1"
FT                   /translation="MALRDLVQKVALAVPSPVVAGGARALFGLPVHLKRRIVGPAPRVD
FT                   GNEMDVDSQLTLLLLKAQGITGIGGTDVATARVRMRRLGQAVGAGTAPDVATRGLLVDG
FT                   AAGTLPARLYTPKDLPAGSPLVVFFHGGGFVLGDLESHDAPCRYIADRVGARVLSVDYR
FT                   LAPEAVFPAAADDAVAATAWAIEHADQLGADPVRVAVSGDSAGGNLAAVACRELSLRGG
FT                   PQPRVALLFYPVTGADPGNRSRDTFATGYFLTKADIEWTRERYLPEPGQDEDPKFHVLH
FT                   ADNLGGVGRTHVVVAGFDPLRDEGAAYAQRLREAGVDATTQLAPGALHGFLNSVGVSAD
FT                   ARVDVDTALDVLRNELVAKS"
     atggcactca gagatctcgt gcagaaggtc gcgctcgccg ttcccagccc ggtggtcgcc        60
     ggcggggcac gcgccctgtt tggccttccg gttcacctca agcgacgcat cgtcggtccg       120
     gcgccgcggg tcgacggcaa tgagatggac gtcgactccc agctgaccct gctcctgctc       180
     aaggcgcaag gaatcaccgg tatcggtggc accgatgtcg cgacggctcg cgtgcggatg       240
     cgccgcctcg gacaggccgt gggcgcggga acggcaccgg acgtggccac gcggggtctc       300
     ctggtcgacg gcgccgcggg caccctgccc gcacggctgt acaccccgaa ggacctccct       360
     gccggatcgc cactcgtggt gttcttccac ggcggaggtt tcgtcctggg cgatctggaa       420
     tcccacgacg caccctgccg gtacatcgcc gaccgggtcg gggcgcgcgt gctgtccgtg       480
     gactaccggc tcgctcccga ggcggtcttc cccgccgcgg ccgacgacgc cgtcgcggcc       540
     acggcctggg cgatcgagca cgccgatcag ctcggtgcgg atccggtccg cgtcgccgtc       600
     tccggagaca gcgcgggcgg caatctggcg gcggtcgcct gccgcgaact gtcgctgcgg       660
     ggcggcccgc aaccgcgtgt cgcgctcctg ttctacccgg tgacgggggc cgatccgggc       720
     aaccgcagcc gcgacacctt cgccacgggg tacttcctga cgaaggctga catcgagtgg       780
     acccgcgagc ggtacctccc cgagccgggg caggacgagg atccgaagtt ccacgtgctg       840
     cacgccgaca acctcggtgg cgtgggccgc acgcacgtcg tggtggccgg attcgacccc       900
     ctgcgcgacg agggcgcggc ctacgcacag cgcttgcgtg aggccggagt ggacgccacg       960
     acacaactcg cgcccggcgc gttgcacgga ttcctgaatt cggtcggcgt gagcgccgac      1020
     gcacgcgtcg atgtggacac cgcccttgac gtgctacgga acgagctcgt cgcgaaatct      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page