(data stored in ACNUC1104 zone)

EMBL: CP001966.PE83

CP001966.PE83        Location/Qualifiers
FT   CDS_pept        complement(90889..91491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0083"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   pmy:Pmen_0131 FMN-binding negative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76737"
FT                   /db_xref="GOA:D5UPW9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW9"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ADG76737.1"
FT                   /translation="MYVAAPDRSDDERARAMVAAAGIGTVFSASGGLHASTLPLLWEGD
FT                   TVIAHLATANRHWRGLDGAEVLIVVTGPDAYVSPGWYPSKAAHGRAVPTWNYSEVQLRG
FT                   RASIHEDAAACRAIVARLTARHERNRPEPWGLDDAPPAYIEQQLKAIVGLTVEVTAVAA
FT                   KQKWSRGRSAEDIAGVQTALDSADPRAGAEMRRARGL"
     atgtacgtcg ccgcacccga ccgttccgac gacgagcgag cccgcgccat ggtggccgcc        60
     gccggcatcg gcaccgtgtt ctcggcctcg ggcgggctgc acgcgagcac gctaccgctg       120
     ctgtgggagg gcgataccgt gatcgctcac ctcgccacgg cgaaccgcca ctggcgcggg       180
     ctcgatggcg ccgaggtcct catcgtggtg acggggccgg atgcctacgt ctcgcccggg       240
     tggtacccgt ccaaggccgc gcacggtcgc gccgtgccca cgtggaacta cagcgaggta       300
     cagcttcgcg gccgcgcgag catccacgag gacgcagcgg cgtgccgcgc tatcgtcgcc       360
     cggctcaccg cccggcacga acggaaccgg cccgagccct ggggcctgga cgacgccccg       420
     cccgcataca tcgagcaaca gctcaaggcg atcgtcggcc tcacggtcga ggtgacggcc       480
     gtggcggcca aacagaaatg gagtcgcggc cgcagcgccg aggacatcgc cggcgtgcag       540
     acagcgctcg acagcgccga cccgcgggcc ggcgccgaga tgcgccgtgc gcgcggattg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page