(data stored in ACNUC1104 zone)

EMBL: CP001966.PE85

CP001966.PE85        Location/Qualifiers
FT   CDS_pept        92044..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0085"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_3479
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76739"
FT                   /db_xref="GOA:D5UPX1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76739.1"
FT                   /translation="MNVSGATTSLESDVVSPGRNDQTAQSILSAAVASIGSVGISRTTM
FT                   EHVANLAGIGVATVYRRFNRKDNLVQQAIRYEAEQLLKTIEQQIAGLPTVEEALTEGFV
FT                   AFLREAHRRPLIRGIGDGNVVVGLPMIAQGGAMLIEIGRTFAANIIEGFQDKGDLPEFD
FT                   PKPIAEIFARVGHSVLLAPDGLISFDDPYAAGRVVRECLMPAIAAQTAAAATEGAS"
     atgaacgttt ccggggccac caccagccta gaatcggacg ttgtgagtcc cggcagaaac        60
     gatcagaccg cgcagagcat cctgtctgcg gcggtggcga gcatcggcag cgtcggtatc       120
     tcgcgtacca cgatggagca tgtggcgaac ctcgccggca tcggcgtggc caccgtctac       180
     cgccgcttca accgcaagga caacctggtc cagcaggcga tccggtacga ggccgagcaa       240
     ctgctcaaga ccatcgagca gcagatcgcg ggcttgccca cggtcgagga agcgctgacc       300
     gagggattcg tggccttcct ccgcgaggcc caccgccggc ccttgatccg cggtatcggc       360
     gacggcaacg tggtggtcgg cctgccgatg atcgcgcagg gcggcgcgat gctcatcgag       420
     atcggccgca ccttcgcggc caacatcatc gagggcttcc aggacaaggg agacctaccg       480
     gagttcgacc cgaagcctat cgccgagatc ttcgcgcgcg taggtcattc ggtgctgctc       540
     gcgcccgacg gcctgatcag cttcgacgat ccgtacgccg cgggccgggt ggtccgcgag       600
     tgcctgatgc ccgccatcgc cgcgcagacc gccgcggccg ccaccgaggg agcctcatga       660
//

If you have problems or comments...

PBIL Back to PBIL home page