(data stored in ACNUC1104 zone)

EMBL: CP001966.PE89

CP001966.PE89        Location/Qualifiers
FT   CDS_pept        complement(95218..96444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0089"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   nfa:nfa38830 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76743"
FT                   /db_xref="GOA:D5UPX5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76743.1"
FT                   /translation="MSITEQPRTTTARPHPQAWSFALLLTLLALALGVSGLPSPLYPLY
FT                   QQQWHLSALSTTLVFAVYAIGALGAALTVGPVSDAIGRKPVLLVAVATILVGLVIFLFA
FT                   GAEWQLILARFLHGAAIGSITVVAGAALLDVRPTEGARNGMLSGVFLNVGIAATALGAA
FT                   AVAQYAPSPLRTPFIAMGVVVLAVLAGVISLVEPHAARTGGRVRFSRPRVPGEITSDFW
FT                   FSGIGIVTAWSVLGVFLSLYPALVQHVTGHRSVLFTGMLVAVMAVASAIAQYLGGRYPA
FT                   RPTAIVGDLGLVLSLGVAVLALRSGATWLILADTVALGATFGLAFGGSLRHLASVAPAH
FT                   ARGQVMSAYYLLGYLAMGVPTVIAGYLATEYGTAAIFPWFAAAVAAGCLIAAAIGVRSG
FT                   RAAAPAPAA"
     atgagcatca ccgagcaacc gcgcaccacc accgcccggc cgcaccctca ggcctggtcg        60
     ttcgcgctcc tgctcaccct gctcgcactc gctctgggcg tctccgggtt accgtcaccc       120
     ctctaccccc tctaccaaca gcagtggcac ctctcggcgc tgtcgaccac gctcgtcttc       180
     gccgtctacg ccatcggcgc gctcggcgcg gcgctcacgg tggggcccgt ctccgacgcc       240
     atcggccgca agccggtgct cctcgtcgcc gtggcgacca tcctcgtggg actggtgatc       300
     ttcctcttcg ccggcgccga gtggcagctc atcctcgcgc ggttcctgca cggcgcggcc       360
     atcggttcga tcaccgtggt cgccggcgcc gcactcctgg acgtgcgtcc caccgaaggc       420
     gcccgtaacg ggatgctgtc cggcgtcttc ctcaacgtcg gaatcgcagc caccgcgctc       480
     ggcgccgccg cggtcgcgca gtacgcgccc agcccgctgc gcaccccgtt catcgccatg       540
     ggcgtggtgg tactggccgt gctcgccggc gtgatctcac tggtcgaacc gcacgccgct       600
     cgaaccggcg gccgggtgcg gttctcccgc ccacgggtcc ccggcgagat cacgtccgac       660
     ttctggttct ccggcatcgg catcgtcacc gcgtggtcgg tactcggcgt cttcctgagc       720
     ctgtatccgg cactggtaca gcacgtcacg gggcaccgct cggtcctgtt caccgggatg       780
     ctggtggcgg tcatggccgt cgcctcggcg atcgcccagt acctcggcgg ccgttacccc       840
     gcgcggccca cggcgatcgt cggcgacctg ggcctggtgc tctcgctcgg cgtcgcggtg       900
     ctggcgctgc gctccggcgc gacctggctg atcctggccg acaccgtcgc gctgggcgcc       960
     accttcggac tggccttcgg tggctcgctg cgccacctgg cgtcggtcgc tccggcgcac      1020
     gcgcgtggcc aggtgatgag cgcctactac ctgctgggct acctcgcgat gggtgtgccc      1080
     accgtgatcg ccggctacct cgccaccgag tacggcaccg ccgcgatctt cccgtggttc      1140
     gccgccgcgg tggccgcggg gtgcctgatc gccgccgcga tcggcgtccg cagcggccgc      1200
     gccgccgccc cggcgcccgc cgcctag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page