(data stored in ACNUC1104 zone)

EMBL: CP001966.PE91

CP001966.PE91        Location/Qualifiers
FT   CDS_pept        complement(96809..97504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76745"
FT                   /db_xref="GOA:D5UPX7"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX7"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03732"
FT                   /protein_id="ADG76745.1"
FT                   /translation="MQRARLVIIAGAIFYSAWIFAPTMGSRLNGLRSYVSEVAATGQPY
FT                   AHFFRGTDLLAGTCFVVGAALWWRAARPSSRFAWGWMAGMIMLGVGTISDALLPLSCTP
FT                   TSDAACAFREANGEVPFTHLAHAYSSGIAGTGGAVAVLAWAAWLLRGGNDGALRTARPL
FT                   TVAAFGAGMTYLITTVWTLAAMAITDPELYLGLAQRLQIAGITSWLVLIALPVGKRSAP
FT                   PDPPRPAPS"
     atgcagcgcg cccgcttggt gatcatcgcc ggcgcgatct tctactcggc atggatcttc        60
     gctcccacca tgggctcccg gctcaacgga ttgcggtcct atgtgagcga ggtggcggcc       120
     accggccagc cgtacgcgca cttcttccgc ggcaccgacc tgttggccgg cacgtgcttc       180
     gtggtcggcg ccgcgctgtg gtggcgagcc gcccgcccgt cctcgcggtt cgcgtggggc       240
     tggatggccg ggatgatcat gctcggcgtc ggcacgatct cggacgccct cctgccgctg       300
     tcctgcacac ccacctccga cgccgcatgc gccttccgcg aggccaacgg cgaggtgccc       360
     ttcacccacc tcgcgcacgc ctactcgtcg ggaatcgccg ggaccggcgg cgcggtggcc       420
     gtgctggcct gggcggcgtg gctgctgcgc ggcgggaacg acggtgcgct gcgcacggcc       480
     cggccgctca ccgtggccgc cttcggcgcg gggatgacct acctgatcac cacggtgtgg       540
     acactcgccg cgatggcgat caccgacccg gagctctacc tgggcctcgc gcagcggctc       600
     cagatcgccg gtatcacgtc gtggttggtg ctcatcgccc tgccggtggg gaaacgttct       660
     gcaccgcccg atccgccgcg tccagcaccg agctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page