(data stored in ACNUC1104 zone)

EMBL: CP001966.PE96

CP001966.PE96        Location/Qualifiers
FT   CDS_pept        102709..103356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_19470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76750"
FT                   /db_xref="GOA:D5UPY2"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY2"
FT                   /inference="similar to AA sequence:KEGG:RER_19470"
FT                   /protein_id="ADG76750.1"
FT                   /translation="MLMNPRLWAAASVAAGSFLALAALYLVLVGTATGQYVDHEVMLRV
FT                   SAAFGVEFPTSGWFGDMQMPLLLVGFATTAVLVAASRSVRTAVEAAAVLLLTLGGAYVL
FT                   KALLERPSFGVGPMINSFPSNTVAVFAALAAVAFITAPSALRSIVLSYALGVGAVASVT
FT                   VIALQWHRPGDVLGAWLVAACAAGAVRAYGAAWSAETILRRPVGGRTAAHRG"
     atgctcatga atccccgtct ctgggccgcg gccagtgtcg ccgccggttc ctttctggcg        60
     ctcgccgcgc tgtacctcgt gctggtcggc acggcgaccg ggcaatacgt cgaccacgag       120
     gtgatgctcc gcgtgtccgc cgccttcggc gtcgagttcc ccacctccgg ctggttcggc       180
     gatatgcaga tgccgctgct gctggtgggc ttcgccacca ccgccgtgct cgttgcggcg       240
     agccggtccg tgcgcaccgc cgtcgaggcg gccgccgtcc tgctgctgac gctgggcggc       300
     gcgtacgtcc tcaaggcact gctggagcgg ccgtcgttcg gggtcggccc gatgatcaac       360
     tccttcccct cgaacacggt cgccgtcttc gccgcgctcg ccgccgtcgc gttcatcacc       420
     gccccgtcgg ccctccggtc gatcgtcctc agctacgcgc tgggcgtcgg tgcggtggcc       480
     tcggtcaccg tgatcgctct gcagtggcac cgcccgggcg atgtcctcgg cgcgtggttg       540
     gtcgcggcat gcgccgccgg cgcggtccgg gcgtacggtg ccgcgtggag cgccgagacg       600
     atcctgagga ggccggtcgg tggtcgcact gctgctcatc gaggatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page