(data stored in ACNUC1104 zone)

EMBL: CP001966.PE98

CP001966.PE98        Location/Qualifiers
FT   CDS_pept        104035..105387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0098"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: rer:RER_19450 two-component histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76752"
FT                   /db_xref="GOA:D5UPY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76752.1"
FT                   /translation="MAGSLRARLLVIIVLVTSFTAAVTGASVAYVVRDWVYEDAQQAVL
FT                   TAFRHDMERFDDQPTMENLLGDYLVTTSDGGVVQPGTVPPGTVPSSMSADLRATPSIYR
FT                   FQRLADGRLLVGHSSSKHPYLIYSVQPLEGVQQRLRQLMTFVALATLGGALLGGLAGVL
FT                   VARAVTRPLRRVQDVASAVAAGDSTARLPETSLAELRELSVNFNGMLDRQNESLDVLRR
FT                   QDERSRRFASDVSHELRSPLAALVPAAEVLREEADAMAAESSGHPDLARAARMVASEVD
FT                   GLAQLLDDLLEITRLDAGVAQVRAEEFDLVATVREALDARGWSGVRIDGPGELWVNADR
FT                   RRVVAVVTNLVGNALRHGAPPVTVSMHRWAQQGDGGAVVEVRDHGGGVPEGHEDLIFDR
FT                   LHKAQAARSRGAGGGAGLGLAIARDNARLLGGDVDYRRDGATTVFRAWFRG"
     atggccggga gcctgcgggc gcggctgctg gtgatcatcg tgctggtcac ctcgttcacg        60
     gctgcggtga ccggggcctc ggtggcctac gtcgtgcgcg actgggtcta cgaagacgcg       120
     caacaggccg tgctgaccgc gttccgacac gatatggaac ggttcgacga tcagccgacg       180
     atggagaacc tcctcggcga ctatctggtg acgacctccg acggaggggt ggtgcagccg       240
     gggacggtgc cgcccggcac cgtgccgtcc tcgatgtcgg cggatctgcg ggcgacgccc       300
     agcatctacc gattccagcg actcgccgac ggccgcctgc tggtcgggca cagttccagc       360
     aaacatccgt atctgatcta ttcggtgcag cccttggagg gcgtgcagca acggctgcgg       420
     cagctgatga ccttcgtcgc gctcgccacc ctgggcgggg cactgctcgg cggactagcg       480
     ggggtgctgg tggcgcgcgc cgtgacccgg cccctgcggc gggtccagga tgtggcgtcc       540
     gccgtggcgg cgggcgactc caccgcgcgg ctccccgaga cctcgctggc cgaattgcgc       600
     gagctctcgg tgaatttcaa cggcatgctc gaccggcaga acgaatccct cgatgtgctg       660
     cgccgccagg acgagcgctc ccggcggttc gccagtgacg tctcgcacga gctccgcagt       720
     ccgctggccg cgctggtgcc ggccgccgag gtcctgcggg aggaagcgga tgcgatggcc       780
     gccgagtcgt cgggtcatcc ggatctggcg cgcgcggcgc gcatggtggc ctccgaggtc       840
     gacggcctgg cccagctact cgacgatctg ctcgagatca ctcgcctcga cgcgggtgtg       900
     gcgcaggtgc gggccgaaga attcgacctg gtcgccacgg tgcgggaggc gctggacgca       960
     cgcggatggt cgggcgtgcg gatcgacggg ccgggcgagc tgtgggtgaa cgcggaccgg      1020
     cgccgagtgg tggccgtggt gacgaatctg gtggggaacg ctctgcgcca cggcgcgcct      1080
     ccggtgacgg tgtcgatgca ccgctgggcg cagcagggtg atggcggagc cgtggtcgag      1140
     gtgcgcgacc acggtggcgg agtgcccgag gggcacgagg acctgatctt cgaccgcttg      1200
     cacaaggcgc aggcggcgcg ctcgcgcggc gcaggcggcg gtgcgggcct gggcctggcg      1260
     atcgcccggg ataacgccag gctgctcggc ggcgatgtcg actaccggcg cgacggcgcc      1320
     accaccgtct tccgggcctg gttccgcggc taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page