(data stored in ACNUC30630 zone)

EMBL: CP001977.COBA

CP001977.COBA        Location/Qualifiers
FT   CDS_pept        501666..502442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="HMPREF0675_3473"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00330"
FT                   /db_xref="GOA:D4HBP6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP6"
FT                   /protein_id="ADE00330.1"
FT                   /translation="MIYSADLVPGTVTLVGGGPGDPGLLTVAGFEAVRQADVILYDRLA
FT                   PTAIMDENPQAERIPVGKVPRGPYVPQERTNELLIEHAKAGRKVVRLKGGDSFVFGRGG
FT                   EEWQACAAAGVPVRIIPGVTSCVAGPELMGVPLTHRHMVQGFTVVSGHVAPGDTRSELD
FT                   WAQIAKTGTTLVILMGVAHIGDIATRLMDGGLAGDTPVAIIADASLPTQRSLTTTLEKA
FT                   AEDMAEAEINPPAITVVGDVAGLDLDGTQAHVPSDH"
     atgatctact ccgcagacct cgttcccggc accgtcactc tcgtcggagg tggccctggt        60
     gatcccggat tgctgaccgt cgcgggattt gaggcggttc gccaggccga cgtcatactt       120
     tacgaccggc tcgctccaac cgccatcatg gatgagaatc cccaggccga gaggatcccg       180
     gtcggtaagg tgccgcgcgg gccttacgtc ccccaggagc gcaccaacga actgcttatc       240
     gagcacgcca aagctgggcg taaggtggtg cgcctcaaag gcggcgattc cttcgttttt       300
     ggtcgcggtg gcgaggagtg gcaggcctgc gctgctgctg gcgttccggt gcgcatcatc       360
     cccggcgtca cttcatgcgt agccggtccc gagctcatgg gggttccgct gacacatcgt       420
     catatggtgc agggatttac cgtcgtttcg ggtcacgtcg cccctggcga tactcggtcc       480
     gaattggact gggcccagat cgccaagaca ggcactaccc tggtgattct catgggagtg       540
     gcccacattg gcgacatcgc tacccgcctc atggacggcg ggttggccgg cgacacaccg       600
     gtcgccatta ttgctgatgc ctcactgccc acccagcgtt ctctgacgac gaccctcgag       660
     aaggcagccg aagacatggc ggaagccgag atcaacccgc cggccatcac cgtcgtcggc       720
     gatgtcgccg ggcttgacct cgacgggacc caggcccacg tcccgtctga tcactga          777
//

If you have problems or comments...

PBIL Back to PBIL home page