(data stored in ACNUC30630 zone)

EMBL: CP001977.COBB

CP001977.COBB        Location/Qualifiers
FT   CDS_pept        499233..501656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="HMPREF0675_3472"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /EC_number="6.3.1.-"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01656; match to protein
FT                   family HMM PF07685; match to protein family HMM TIGR00379"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00257"
FT                   /db_xref="GOA:D4HBP5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP5"
FT                   /protein_id="ADE00257.1"
FT                   /translation="MRLPRILIAAPASGGGKTTVATGLMAALRASGRTVAPFKVGPDYI
FT                   DPGYHSMASGRPGRNLDSVMCGDELMAPLLAHGFVTPDPADIAVIEGVMGLFDGQLGTG
FT                   RGSSAEIATTTRTPVVVVVDTAHASLTHAAVVAGLATFDPDVTVAGAILNRVASPRHGA
FT                   EVARGLAQLGIPVLGQIPRTESIFVPSRHLGLVPAGEWEDSATKVAGLGGLIAEYVDLD
FT                   AVMDMAATAPDLDVEPWDPAAALESAGWQGHPFGESPLVGMFAGRAFTFRYPETTEMLI
FT                   AAGFRVVDVDPLTDRRLPDGIQGLYLGGGFPQMHATDLETNSELADDVRSHAEAGMPIV
FT                   AECAGLLYLCRHLDGHEMAGVLPMDAAMAKRLTMGYRVATRDSISVVGHEFHRTTTTPL
FT                   ADLDPAWHITMPDGTDRAEGALGDPAGLGRPTIQASYLHLHWAGQPTQAAWFASEVTKF
FT                   HEGRGDQVVEPDLNHHGDRDIADGLVDLAVNVRVSEPPQWLRDAIISTEHDWARYPDAT
FT                   PGREALAAMHGVPTDMVLPTAGAAEAFPLVATLEPRHAIVVHPQFTEPEAALRAAGISV
FT                   GRHILNVSDGFALDPDLVPDDADLVVVGNPTNPTGRLHPATDLLALRRPGRVLVVDEAF
FT                   MDATDESQSLIGSDMDDLLVLRSLTKTYGLAGIRAGYVVGDSQLVAQLAAHQTPWSVST
FT                   PAIAAMIACTCEEARRFRTQLRDDIPAARADLVDKLKGLGLSVVDSEAPFVLVNTSSLS
FT                   GDSIRQPLAERGFAVRRGETFPGLGPTWIRLAVRDSNIHAELARAISDLTAHRN"
     atgcgccttc cacgaattct tattgccgcc ccggcatcgg gtggtggcaa aacaactgtt        60
     gctaccggtc tcatggcagc tcttcgcgcc agtggccgga cggtggcgcc tttcaaggtc       120
     ggaccggact acatcgaccc cggataccac tcgatggcga gtggacgtcc cggtcgcaac       180
     ctcgactccg tgatgtgcgg tgacgagctc atggcccctc tgctagccca cggtttcgtc       240
     acccctgatc cggccgatat tgcggttatt gagggggtta tggggctgtt cgacggccag       300
     cttgggactg gccgtggctc cagcgccgag atcgccacga cgacccgaac tccggttgtc       360
     gtggtcgttg acaccgcgca tgcttcgctc acccatgccg ccgtcgtggc tggtttggcg       420
     acgttcgatc ctgacgtcac cgttgcgggg gcgattctta accgggtggc ctcaccccgt       480
     cacggtgccg aagtcgctcg gggcttggcc caactgggta tcccggtgct cggtcagatc       540
     ccgcgtaccg agtcgatctt tgtgccgtcg cgccacctcg gtctggtgcc agcgggggaa       600
     tgggaagact ccgcgaccaa ggttgccggg ctggggggcc tcattgccga atacgtcgat       660
     cttgacgccg ttatggatat ggctgctact gcccccgacc tcgacgtcga gccgtgggac       720
     cccgccgctg ccctggaatc cgccggctgg caaggccatc cattcggtga gtcgccgctt       780
     gtgggtatgt tcgccggacg ggccttcacc ttccggtacc ccgagaccac cgagatgctg       840
     atagcggcag ggttccgggt cgtcgacgtt gatcccctta cggatcggcg ccttcctgac       900
     ggcatccaag gactgtattt gggaggcggc tttcctcaga tgcatgccac cgatttggaa       960
     accaactcgg agctggcgga cgacgtacgg tcccacgctg aggccgggat gccgattgtc      1020
     gccgagtgcg ccgggttgtt gtatctgtgc cgtcaccttg acgggcacga gatggctggc      1080
     gtgctaccga tggatgcggc catggcaaag cggctcacga tggggtaccg cgtcgctaca      1140
     cgtgactcca tcagtgtcgt tggtcacgaa tttcaccgca ccacgacgac tccgctggcc      1200
     gacctcgacc cggcgtggca catcacgatg cccgacggca ccgaccgcgc cgagggggct      1260
     ttgggagatc cggcggggct gggccggccc acgattcagg cgtcctacct gcacctgcac      1320
     tgggccggtc agcccaccca agcagcgtgg tttgccagcg aggtgacgaa gttccacgag      1380
     ggccgaggtg atcaagtcgt tgagcccgat ctcaaccatc acggggatcg tgacatcgcc      1440
     gacggtttgg tcgacctggc cgtcaacgtg cgcgtgagtg agccgccgca gtggcttcgc      1500
     gacgccatca tctccaccga gcatgactgg gcccgttacc ccgatgccac gccgggtcgc      1560
     gaggccctgg cggccatgca cggggtgcct accgacatgg tgctgcccac cgcaggtgct      1620
     gcagaggctt tcccgctggt cgccaccctc gaacctcgtc acgcaatcgt cgtccacccc      1680
     cagttcaccg agcccgaagc tgctctgaga gcggccggga ttagcgtcgg tcggcacatc      1740
     cttaacgtgt ccgatgggtt cgccctcgac ccggacctcg tccccgacga tgccgacctc      1800
     gtcgtcgtcg ggaacccgac gaatcccact ggcagactgc acccggctac tgacctgctg      1860
     gctctgcgcc gccccggaag ggtcctcgtt gtggacgagg ccttcatgga cgccaccgat      1920
     gagtcccagt cccttattgg aagcgatatg gacgacctcc tcgtcctgcg ctccctgaca      1980
     aaaacctacg gtctggctgg aatccgggcc ggatatgtcg tcggtgattc acagctcgtc      2040
     gcacagttgg cagctcacca gaccccatgg tcggtgtcga ctccagcaat tgcagccatg      2100
     atcgcgtgca cctgcgaaga ggctagacgt tttcggaccc agttacgcga cgacatccca      2160
     gccgcccgcg ccgacctcgt cgacaagctt aaaggcctcg ggctgagcgt tgttgactcc      2220
     gaggctccct ttgttttggt caacacatcg tctctcagcg gggattcgat acgccagccc      2280
     cttgccgagc gtggtttcgc tgtgaggcgg ggggagacgt tccccgggct cgggcctacc      2340
     tggatcagac tcgcagtccg tgactcgaat attcatgccg agctcgctcg agctatctcc      2400
     gatctgacag cacaccgcaa ctaa                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page