(data stored in ACNUC30630 zone)

EMBL: CP001977.EDA

CP001977.EDA         Location/Qualifiers
FT   CDS_pept        complement(441075..441722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="HMPREF0675_3412"
FT                   /product="KHG/KDPG aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00026"
FT                   /db_xref="GOA:D4HB52"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB52"
FT                   /protein_id="ADE00026.1"
FT                   /translation="MSNEALNTVLSHLVIPVVVIHDAATTPAVTDGLVVGGLPVAEVTF
FT                   RTDAAPAAIESMAGDGRITVGAGTVINARQVDEAVSAGASFVVSPGLSREVVDRCRHHA
FT                   IPVLPGAITPTEIMAGIDMGLDTFKFFPAGTFGGAATIASLEGPFPHLRFVPTGGVKPH
FT                   NLADFLSRANIPAVGGTWLTPADAVAARDCHTIANLVREAVDSAHHIVKEQS"
     atgagcaatg aagcactcaa cactgtgttg tcacatctgg tcatcccagt agtcgtcatc        60
     catgacgccg ccactacccc agccgtcacc gacgggctgg tcgtcggtgg ccttccggtc       120
     gccgaggtga ccttccgtac cgatgccgcc ccagccgcca tcgagtccat ggccggtgac       180
     ggccggatca ccgtcggcgc cggaaccgtc atcaatgccc gccaagtcga tgaggcggtg       240
     agcgccgggg cgagcttcgt cgtctccccc ggcctctccc gcgaggtcgt cgatcgatgt       300
     cggcaccatg ccatcccggt tctgccgggg gccatcaccc cgaccgaaat tatggctggc       360
     atcgacatgg gactcgacac cttcaagttc ttcccagccg gcaccttcgg cggtgcagcc       420
     accatcgcgt cgctggaagg ccctttcccg cacctacgtt tcgtccccac cggtggggtc       480
     aagccgcaca acctcgcaga tttcctctcc cgcgccaata ttcctgccgt cggaggtacc       540
     tggctcaccc cggctgatgc cgtcgccgcc cgggactgcc acaccatcgc caacctagtc       600
     cgcgaagccg tcgatagcgc ccaccacatc gtcaaggagc agtcatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page