(data stored in ACNUC30630 zone)

EMBL: CP001977.FHS

CP001977.FHS         Location/Qualifiers
FT   CDS_pept        47388..49097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="HMPREF0675_3049"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by match to protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00550"
FT                   /db_xref="GOA:D4HEK7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK7"
FT                   /protein_id="ADE00550.1"
FT                   /translation="MIGAMTMKSDLEIAREAHLDPIEKVAARAGIDEKYLEPYGRGVAK
FT                   VDLDVVTHNRDHSCGKYVVVTAMTPTPLGEGKTTTAVGLAQGLEKIGKHSVLALRQPSM
FT                   GPTFGIKGGAAGAGYSQVLPMEKLNLHLTGDFHAIGAAHNLLAAMIDNHLHQGNELDIE
FT                   PHSISWRRVVDINDRALRNTIVGLGSRVDGVPRETGFDITAASEVGVILSLATSLSDLR
FT                   ARLGRIVIGYNRSKEPVSAEDLHAAGSMAVILKDALKPNLLQTTENSPVLVHAGPFGNI
FT                   ATGNSSVIADRVGIGCGDYLLTEAGFGADMGAERFFNIKCRIGGMRPDAAVLVATVRAL
FT                   KTHAGRYKVIPGKPLPPAMLEDNPDDVLAGAANLRKHIEIVREFGVSPIVALNVFPTDH
FT                   PDEIDAVRKVAEAAGAHFASSTHVVDGGDGAVDLAHAVVAACDHKADFRYTYDLEDSLV
FT                   EKLTKVATKVYGADGIDIAPAAAKELAHFEDLGYGTFPVVIAKTHLSLSHDPSLKGAPT
FT                   GWRLPVREVRAAVGAGYIYAICGDMRTMPGLGRHPAAERIDIDDNGETIGLF"
     atgattggag ctatgacaat gaagtcggat cttgaaattg cccgcgaggc ccaccttgac        60
     cccatcgaga aggttgcagc ccgggcaggc attgatgaga aatacctgga gccctatggg       120
     cgcggcgtcg cgaaggtgga cctcgatgtc gtcacacaca acagggatca ttcttgcggt       180
     aaatacgtcg tcgtcacggc catgactccc acgcctcttg gtgagggcaa aacgaccacc       240
     gctgttggtc tagcccaggg cctagagaag atcggcaaac atagcgtgct ggccctacgc       300
     cagccgtcga tgggcccaac tttcggaatc aagggcggtg ccgctggcgc tggatactcc       360
     caggtgctgc cgatggagaa gctcaatttg cacctgactg gtgacttcca tgccattgga       420
     gcggcccaca acctgcttgc cgccatgatc gacaaccatc tgcaccaggg caacgagctc       480
     gacattgaac ctcactcgat ctcgtggcgt cgcgtcgtcg atatcaatga ccgtgccctg       540
     cgcaacacca ttgttggtct tggatcgagg gtcgacggcg tcccccgcga gaccggattc       600
     gatatcaccg cggctagcga ggttggcgtc atcctgtcct tggccacctc cttgtccgac       660
     ctgcgtgctc gcctggggcg tatcgtcatc ggctataacc gctccaaaga gccagtcagc       720
     gccgaggatc tgcacgccgc cggatcgatg gccgtcattc ttaaagacgc cctcaagcca       780
     aacctattac aaactaccga gaacagcccg gtgctcgttc acgccggccc ctttggcaat       840
     atcgccaccg gtaactcctc ggtcatcgca gaccgcgtcg gtatcggttg cggcgattac       900
     ttgctcaccg aggccggatt cggtgctgac atgggagctg agcggttctt caacatcaaa       960
     tgccgcatcg gtgggatgcg ccccgacgct gccgtcctcg tcgccaccgt gcgtgccctc      1020
     aaaacccacg ccggtcgcta caaagtcatc cccggaaagc ccctgccccc ggcaatgctg      1080
     gaggacaacc ctgacgacgt gctcgctggt gctgccaatc tgcgcaaaca catcgagatt      1140
     gtgcgtgagt tcggcgtctc cccgattgtg gctctcaacg ttttcccgac cgatcacccc      1200
     gatgagatcg atgccgtccg taaagtcgct gaggccgccg gagcccattt cgcctcttcg      1260
     acccatgtcg tcgatggcgg tgacggtgcc gtcgacctgg ctcacgcggt cgtggcagcc      1320
     tgtgaccaca aggccgactt ccgctacacc tacgaccttg aggactctct agtcgagaaa      1380
     ctgaccaagg ttgctaccaa ggtttatggg gctgacggaa tcgacatcgc cccagcggca      1440
     gccaaggagc tggcccactt cgaggatctc ggctacggca cattcccggt tgtcatcgcg      1500
     aagacccacc tatccctgtc ccatgaccca tccctcaagg gcgccccgac cggatggcgg      1560
     ttgcctgtgc gcgaggtgag ggccgccgtc ggagctggat acatctacgc gatctgcggc      1620
     gacatgcgca ccatgccggg cttgggccgt cacccggccg ccgagaggat agatatcgac      1680
     gataacggcg aaaccatcgg actgttctga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page