(data stored in ACNUC30630 zone)

EMBL: CP001977.GALE

CP001977.GALE        Location/Qualifiers
FT   CDS_pept        71839..72828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="HMPREF0675_3069"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99461"
FT                   /db_xref="GOA:D4HEM7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM7"
FT                   /protein_id="ADD99461.1"
FT                   /translation="MKILITGGAGYIGSTVGSACEEAGHEVVVLDDLSAGRREFVRDRT
FT                   FYEGDIADQDLLDRVFSENQIDAVVHCAAKIIVPESVDEPLTYYGNNVGKTVALLKGME
FT                   RNGVHRILFSSSASIYATDEEFKVTEESALDPGSPYATTKFMVEFILRDAAHASDLKAL
FT                   SLRYFNPIGSDPKLRTGQQIEHPTHVLGKMIDAWMEGSTFTVTGVDWPTRDGSGIRDYI
FT                   HVWDLARAHVAALEHLDEVTTDDPYQVFNIGTGSGVTVKELVKAFEEGTGKSLNVVYGP
FT                   PRPGDVAGAYTVSRRAKDLLGWSAELTQADGIRDAIAWLPERKKILGY"
     atgaagattc tcatcaccgg cggggccggt tacatcggat caacggttgg ttcggcatgt        60
     gaggaggccg gccatgaggt cgtcgtgctg gacgacctat ccgcgggacg ccgcgaattc       120
     gttcgcgacc gcacgttcta cgagggcgac atcgctgatc aggacctgct cgatcgcgtc       180
     ttctccgaga accagatcga cgccgtcgtc cactgcgcag ccaagatcat cgtccccgaa       240
     tcggttgatg agccgctgac ctattacggc aacaatgtcg gcaagaccgt tgctctgctc       300
     aagggaatgg agcgcaacgg cgtacaccgc atcttgtttt cgtcctcggc gtcgatctat       360
     gccactgacg aggagttcaa ggtcactgag gaatccgctc tggaccccgg ttccccctat       420
     gccaccacca agttcatggt ggagttcatc ttgcgtgacg ccgcgcacgc ctctgatctc       480
     aaggcattga gcctgcggta ctttaacccg atcggttcag acccgaagct gcgtactggt       540
     cagcagattg agcatcccac ccacgtgctc ggcaagatga ttgacgcctg gatggagggt       600
     tccactttca ccgtcactgg agtggactgg ccgactcgtg atgggtcagg tattcgcgac       660
     tacatccacg tttgggatct ggctcgcgct catgttgctg ctttggagca tctcgatgag       720
     gttacgaccg acgacccgta ccaggtattc aatatcggta ccggaagcgg cgttaccgtt       780
     aaggagctcg ttaaggcctt cgaagagggt acgggtaaat ccctcaatgt cgtctacggc       840
     ccgccgcgtc ccggcgatgt cgcaggtgcc tacacggtgt cccgccgggc caaagacctg       900
     ctcggttgga gcgcggagct gacccaggcg gatggaatcc gtgacgccat tgcatggttg       960
     cccgagcgca agaagatcct gggttactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page