(data stored in ACNUC30630 zone)

EMBL: CP001977.GLYA

CP001977.GLYA        Location/Qualifiers
FT   CDS_pept        complement(438383..439858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0675_3410"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00072"
FT                   /db_xref="GOA:D4HB50"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB50"
FT                   /protein_id="ADE00072.1"
FT                   /translation="MSDPRAVDPTARDIAEKLAPAYRTMLDAIAQVEPRIAEATRAELT
FT                   DQRHSLKLIASENYASLPVLATMGTWFSDKYAEGTAGHRFYAGCQNVDTVETIAAEHAC
FT                   ALFGAEHAYVQPHSGIDANLTAYWTILAHHIETPALSEFGARTVNDLTQVDWDTLRHRF
FT                   NDQRAIGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPQTGLLDYDKVAELAREFKPLV
FT                   IVAGYSAYPRRVNFAKMREIADEVGAVLMVDMAHFAGLVAGKVFTGDENPIPHAQVVTT
FT                   TTHKSLRGPRGGMVLTTKDYADDVDRGCPMVLGGPLSHVMAAKAVALAEARTQTFRDYA
FT                   QRVANNAKALAEGLMKRGVKLVTDGTDNHINLLDVTTSFGLTGRQAEAALLDAGVVTNR
FT                   NSIPTDPNGAWYTSGIRIGTPALTSRGFGPDEFDQVAELIVTTLEATTPMTASTGKPGK
FT                   AKYQIADGVAQKVHDAADELLGNFPLYPGLDLA"
     gtgagtgatc cccgtgccgt cgatcccact gcccgtgaca ttgccgagaa gctagccccg        60
     gcctaccgca ccatgctcga cgcgatcgca caggtcgagc cgcggatcgc ggaggccacc       120
     cgtgctgaac tcaccgacca gcgtcattcc ctcaaactta ttgcttccga aaactacgca       180
     tccttgccag ttctggcgac catgggtacc tggttctctg ataagtacgc cgaaggtact       240
     gccggccacc gcttctacgc cggttgccaa aacgttgaca ccgtcgagac gatcgccgcc       300
     gagcatgcct gcgctctgtt cggcgctgag cacgcttacg tacagcccca ctccggcatt       360
     gacgccaacc tcaccgccta ctggacgatc ctggcccacc atatcgagac cccagccctg       420
     tcagaatttg gcgcccgcac tgtcaatgac ctcactcaag ttgactggga caccctgcgt       480
     catcgtttca atgaccagcg ggcgatcggc atgagcctcg atgctggtgg ccaccttacc       540
     cacggtttcc gccccaatat ctccggaaag atgttcgacc agcgctccta cggcaccgat       600
     ccgcaaacgg gcctgctcga ctacgacaag gtcgctgagc tggcccgcga gtttaagccg       660
     cttgtcatcg tcgccggata ctccgcctac ccgcgccgcg ttaatttcgc aaagatgcgc       720
     gagattgccg acgaagtcgg tgctgtgctc atggtcgata tggcccactt cgctggcctg       780
     gtagctggca aagtcttcac tggtgacgag aaccccatcc cccacgccca ggtcgtgacg       840
     acgacgaccc acaagtcgct acgcggaccg cgcggcggca tggtgctgac gactaaggac       900
     tacgccgacg acgtcgaccg cggctgccca atggtgctcg gcggcccgct gtcccacgtc       960
     atggctgcca aggccgtcgc tctggcagaa gcgcgcaccc agaccttccg cgactacgct      1020
     cagcgcgtcg ccaataacgc gaaggcccta gccgaaggac tcatgaaacg tggcgtcaag      1080
     ctcgtcaccg atgggactga caaccacatc aacctgctcg acgtcacgac gagcttcggg      1140
     ctgaccggtc gtcaggccga ggccgcgctg ctggacgccg gtgtggtcac caaccgcaac      1200
     tccattccga ctgacccgaa cggcgcctgg tacacctctg gcatacgcat cggcaccccg      1260
     gcactgacct cccgcggatt cggacccgac gaattcgatc aggtcgccga gctcatcgtc      1320
     actaccttgg aggccaccac cccgatgacg gcctccaccg gcaagcccgg caaggccaaa      1380
     taccaaattg ccgacggtgt ggcgcagaag gtccatgacg ccgccgacga gctgctgggc      1440
     aacttccccc tctacccagg gctggatttg gcctga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page