(data stored in ACNUC30630 zone)

EMBL: CP001977.IOLH

CP001977.IOLH        Location/Qualifiers
FT   CDS_pept        530480..531046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolH"
FT                   /locus_tag="HMPREF0675_3503"
FT                   /product="protein IolH"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99598"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS5"
FT                   /protein_id="ADD99598.1"
FT                   /translation="MVDIALDPNMYYCSMSTADTLRKAADLGFRYVELSPNEEFHFWHR
FT                   YPKADDAFVTEMRKAVRETGVTIRTLNPVFNWSSPDEAERRNQMRNWRRLLELADQLDV
FT                   HEITSEFSGDPNSPRECEVAWYRSIEELAPSFERYGIRLNMEAHPYDFIELHDDACRTV
FT                   RGTNLDWIGLRVLLPAHFPSVERGR"
     atggtggata ttgctctaga ccctaatatg tactactgct cgatgtcgac ggcggacacg        60
     ttacgcaaag cggcagatct gggcttccga tacgtggagt tgtctccgaa tgaggagttt       120
     cacttttggc atcggtatcc caaagctgat gacgcctttg ttaccgagat gcgcaaggca       180
     gtcagagaaa cgggggttac catacggaca ctgaatccgg tgtttaactg gtcgagcccc       240
     gatgaggccg agcgacgcaa ccagatgcgc aactggcgac gtctgttgga gctggccgac       300
     cagttagatg tgcatgagat cacctccgag ttctcgggtg atcccaatag tcccagggaa       360
     tgcgaggtcg cgtggtatcg ctccatcgag gagcttgccc ccagtttcga gaggtacgga       420
     atcaggctca acatggaagc gcacccatat gacttcatcg aactccatga cgacgcctgt       480
     cggaccgttc gtgggactaa tctcgactgg ataggtctac gagtactgct gcccgcacac       540
     tttccatctg tcgaacgggg ccggtga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page