(data stored in ACNUC30630 zone)

EMBL: CP001977.KDPB

CP001977.KDPB        Location/Qualifiers
FT   CDS_pept        139133..141247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="HMPREF0675_3121"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99268"
FT                   /db_xref="GOA:D4HF59"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF59"
FT                   /protein_id="ADD99268.1"
FT                   /translation="MTVIPSNSRSRGLTGTQARQALPGALRKLDPRFQWRNPVMFLVWI
FT                   GAVLTTIIAGLELLTGVTDGGVSVGFSMAIAVWLWLTVIFANLAESIAEGRGKAQAESL
FT                   RKTRTATSAIRVDGWDERNDPSAEHTTTTEVVSSELRYGDVVVVAAGQTIPGDGDIVWG
FT                   IASVDESAITGESAPVVRESGGDRSAVTGGTTVLSDRIVVKITSKPGQSFVDRMIALVE
FT                   GSGRQKTPNEIALNILLASLSIVFVLVTLTLNPIASLAARPVSVTVLVALLVCLVPTTI
FT                   GALLSAIGIAGMDRLVQHNVLAMSGRAVEAAGDVTTLLLDKTGTITYGNRRASEFIPMP
FT                   GMSDEEIRDAAARSSLADPTPEGTSIVDLAREQGFVPDACGEQGKVVPFTAQTRMSGID
FT                   LPDGTKIRKGAGSAVRAWLTESHINMDIDTLAHMDRRVDSVSQSGGTPLVVAVRTPDHS
FT                   GKVLGVVHLKDIVKEGLTDRFAELRRMGIRTVMVTGDNPLTAAAIAKEAGVDDFLAEAT
FT                   PEDKLAYIRKEQEGGRMVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSD
FT                   PTKLISIVGIGKQLLITRGALTTFSIANDIAKYFAIIPAIFMATYPGLSALNIMGLHSP
FT                   ASAVLSAIIFNAIIIVILVPLALKGVAYKPAGASKILARNLRIYGLGGVVAPFIGIWLI
FT                   DLIIRLIPGF"
     atgaccgtca tcccttcgaa ttcgcgttcc cgcggtctca ccgggactca ggcgcgtcag        60
     gccctgcccg gagcccttcg taagcttgat ccgcgttttc agtggcgcaa cccggttatg       120
     tttttggtgt ggattggcgc agtcctgaca accatcatcg ctggcctgga actgctcact       180
     ggtgtcaccg acggcggtgt ttccgtcggt ttttccatgg ccattgcggt gtggctgtgg       240
     ctgaccgtca tcttcgccaa ccttgccgag tcgatcgctg agggtcgcgg caaggcccag       300
     gccgagtcat tgcgcaagac ccgcaccgcc accagcgcga ttcgcgtcga cgggtgggac       360
     gagcggaacg atccgtccgc cgagcacacc acgacaaccg aggtcgtctc ctcggagctc       420
     aggtatggcg acgtcgtcgt cgtggcggcg ggccagacga tccctggtga cggcgacatc       480
     gtctggggca tcgcttcggt cgacgaatcg gccatcaccg gtgagtcagc ccccgtggta       540
     cgggagtccg gcggcgaccg ttctgccgtc accggtggta cgacagtgct ttcggaccgt       600
     atcgtcgtca aaatcacctc gaagcccggg caaagtttcg tcgaccgcat gatcgccctg       660
     gttgagggtt ccggacgtca gaagaccccc aacgagattg ccctcaatat cttgctggcg       720
     agcctctcga ttgtctttgt cctcgtcacc ctgaccctca acccaattgc gtccctggcc       780
     gccaggccgg tgagcgtcac ggtattggtg gcgctgctgg tctgcctcgt cccgacgacg       840
     atcggtgctc tgctgtcggc catcggcatc gcgggtatgg accgcctggt gcagcacaac       900
     gtgttggcaa tgtccggacg cgcggtggag gccgccggcg acgttacgac tcttctactc       960
     gacaagactg gcaccatcac ctacggaaac cgtcgtgcca gcgaattcat accgatgccg      1020
     ggtatgagcg acgaagagat tcgcgacgcg gccgcccggt cttcgctggc cgacccgact      1080
     cccgagggca cctccatcgt cgacctggcc cgcgagcagg gcttcgtccc cgatgcctgc      1140
     ggcgaacagg ggaaagtcgt cccctttacc gctcagacca gaatgtcggg catcgacctt      1200
     cccgacggca ccaaaatccg taagggtgcc ggatctgctg tacgcgcctg gctgacggag      1260
     tcccacatca atatggacat cgacacgctg gcgcacatgg atcgccgggt cgactcggtg      1320
     tcccagtccg gtggtactcc gctcgtcgtg gcggtacgca cccccgacca ctcgggcaag      1380
     gtgctcggcg tcgttcacct caaggacatc gtcaaggagg gtctaaccga ccggtttgct      1440
     gagctgcgtc gaatgggcat ccgcactgtc atggtgaccg gagacaaccc gctgaccgca      1500
     gccgccattg ccaaggaggc tggcgtggac gatttcctcg ccgaggccac cccggaggac      1560
     aagctcgcct acatccgcaa ggagcaggag ggtggccgga tggtcgcgat gaccggtgac      1620
     ggcaccaacg atgccccggc tctggcccag gcggacgtcg gcgtcgcgat gaacaccggc      1680
     acctcggctg ctaaggaggc cggcaacatg gtggaccttg actccgaccc gacgaagctc      1740
     atcagcattg tcggaatcgg caagcaacta ctcatcacgc gcggtgccct gacgaccttc      1800
     tcgatcgcca acgatattgc caagtatttt gcgatcatcc cagcgatctt catggcgacc      1860
     tacccgggtc tgtcggccct caacattatg ggtttgcatt ccccagcgtc agcggtgctc      1920
     tcggcgatca tctttaacgc catcatcatc gttattttgg ttccgctggc cctcaaaggc      1980
     gtggcataca agcccgccgg ggcgtcgaaa atcctcgcac ggaacctgcg catctacggg      2040
     ttgggcggtg ttgttgcgcc gttcatcggc atctggctta tcgacctgat tatccgtctc      2100
     attcccggct tctga                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page