(data stored in ACNUC30630 zone)

EMBL: CP001977.KDPC

CP001977.KDPC        Location/Qualifiers
FT   CDS_pept        141260..141865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="HMPREF0675_3122"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00683"
FT                   /db_xref="GOA:D4HF60"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF60"
FT                   /protein_id="ADE00683.1"
FT                   /translation="MIISSRTRTVLVGLRSMLLFTVIVGVVYTGLMTGLGQLMLHHQAN
FT                   GSQLEVNGKVVGSTLIGQSFTDKGGRPLPKYFQPRPSAAGDDGYDAGSSGGSNMGPENP
FT                   DLAKAIKERRSQVAAFNHVDADRVPADAVTASSSGLDPHISPEYANIQIARVAKARHLD
FT                   KAVVRRIVDDNTTGRQLGFLGETKVNVVTLNAELDRQH"
     atgatcatct cctctaggac tcgcaccgtc ctcgtcgggt tgcgctcgat gctgctgttt        60
     actgttatcg tcggcgtcgt gtacaccggc cttatgactg ggctgggcca gttgatgctc       120
     catcaccaag ccaacggctc gcagttggag gtcaacggca aggtggtcgg ctcgaccctc       180
     atcggccagt ccttcaccga caagggtgga aggccgttgc cgaagtactt ccagccgcgt       240
     ccctcggctg ccggtgacga cggttacgat gccgggtcct cgggcggttc caacatgggc       300
     ccggaaaacc cggacctggc gaaggccatc aaggagcgtc gcagccaggt ggcggccttc       360
     aaccacgtcg atgctgaccg ggtacccgct gatgctgtga cggcgtcgtc gtcgggtctg       420
     gacccacata tcagccccga atacgccaat atccagatcg ctcgggtggc gaaggctcgt       480
     catctcgaca aggccgtcgt acggcggatc gttgacgata acaccacggg acgccaactc       540
     gggttcctcg gtgagactaa ggtcaacgtc gtgacgctca atgccgaact ggatcgccag       600
     cactga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page