(data stored in ACNUC30630 zone)

EMBL: CP001977.MOAA

CP001977.MOAA        Location/Qualifiers
FT   CDS_pept        complement(568944..570023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="HMPREF0675_3550"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="identified by match to protein family HMM PF06463;
FT                   match to protein family HMM TIGR02666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99509"
FT                   /db_xref="GOA:D4HC15"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC15"
FT                   /protein_id="ADD99509.1"
FT                   /translation="MTTPQADREDGEVMSAATGQSAAHHGLPDRFGRLATDLRVSVTDH
FT                   CNLRCTYCMPAEGMDWLANRDLLTDDEIIRVIGIGIERLGITKVRFTGGEPLLRPSLEN
FT                   LVAATSTLRRTNGTPPITALTTNGIGLDRRVDGLVEAGLDRVNISLDTVDRERFATISR
FT                   RDRLADVVTGIDAALAARLLVKINAVPQIDSYRRDIPELLVFCLDRGLELRFIEFMPIG
FT                   ANGWKREATVSADDILTVVRDAGFSITADQAARGSSPAQRWSVSSRHTRPGWLGIIASV
FT                   TRPFCANCSRTRLTADGQIRNCLFADQEADLRSLLRSGASDDEIIAVWQGEMWCKSAHH
FT                   GVDNGSFANSRRRMSAIGG"
     atgaccacac cacaggcaga ccgggaggac ggtgaggtca tgagcgccgc gacgggccag        60
     agtgccgccc accatggtct gccggaccgt ttcggacggc tggctaccga cctgcgggtc       120
     tcggtaaccg accattgcaa cctgaggtgc acctattgca tgcccgccga aggcatggac       180
     tggttggcca accgtgacct gctcaccgac gacgagatca tccgtgtcat tggcatcggg       240
     atcgagcgac tcggcatcac caaggtgaga ttcaccggcg gggagcccct gttgcgccct       300
     agtctggaaa acctggtggc cgcaacgtcg acgctgcgcc gcacgaacgg taccccaccg       360
     atcaccgcgc taacgaccaa cgggatcggc ctggaccggc gtgtcgacgg tctcgtcgag       420
     gccggcctag atcgggtcaa catctccctg gacaccgtgg accgcgaacg gtttgccacc       480
     atctcccgac gagaccggct cgcagacgtc gtgacaggga tcgacgcagc cctcgccgca       540
     cgactattag tcaagatcaa tgccgtcccc cagatcgact cctaccgccg tgacattccc       600
     gagttgctcg ttttctgcct ggaccgcggt ctagaactac gattcatcga gttcatgccg       660
     atcggggcga atggctggaa acgggaggca accgtcagtg ccgacgacat cctcaccgtg       720
     gtccgagatg caggtttcag catcaccgct gaccaggctg cgcgcggctc ctcacccgcg       780
     caacgctggt cggtgagctc gcggcacaca cgccccggat ggctggggat catcgcctca       840
     gtgactcgac cgttctgcgc aaactgctcg cgcacccggc tcaccgccga cggccagatc       900
     cgcaactgct tgttcgctga ccaagaggcc gatctgcgtt ccctgctacg ctcaggagcc       960
     agcgatgacg agatcatcgc cgtatggcaa ggtgaaatgt ggtgcaaaag cgcccaccac      1020
     ggggttgaca acgggagttt tgccaactcc cggcgtcgca tgtctgccat tggagggtga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page