(data stored in ACNUC30630 zone)

EMBL: CP001977.MODA

CP001977.MODA        Location/Qualifiers
FT   CDS_pept        570652..571431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="HMPREF0675_3552"
FT                   /product="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00309"
FT                   /db_xref="GOA:D4HC18"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC18"
FT                   /protein_id="ADE00309.1"
FT                   /translation="MIEMSRVSLRTCAIAAVAAVLLAACGSGPSSTQPSAAPTRLTVFA
FT                   AASLTRSYEQIGEQFERKYPRVDVQFSFEGSQNLVAQMAQGAPADVLATADQRSMNKAV
FT                   EQNLVNVPRQFASNVLTLVTPAHNPARVTGLNSSLRGAKLVICAPEVPCGNATRKLANK
FT                   LGVTLKPVSEEQKVTDVRGKVESGEADVGIVYRTDALAAGNKVDVIPIGRANEVVNHYP
FT                   IATAVGATHQGLAKRFVEYVMSADAQKILSDDGFSGP"
     gtgatcgaga tgtcaagagt ctcgctgcgg acctgcgcca ttgcagcagt agcagcggtg        60
     ttgcttgcgg cgtgcggcag tgggccgtct tctacccagc cctcggcagc cccgacgagg       120
     ttgaccgtct ttgccgctgc gtccctcaca aggtcctacg agcagatcgg cgagcaattt       180
     gagcgcaagt atccccgggt cgacgtgcag ttttcctttg aagggtccca gaacctggtc       240
     gcccagatgg cccagggggc cccggctgat gtcctggcca ccgctgatca aaggagcatg       300
     aacaaagcgg ttgagcagaa cttagtgaat gtcccacgtc agttcgccag caacgtgctc       360
     acccttgtta cccctgcaca taatccggcg agggtgaccg gattgaactc ttcgctgcgt       420
     ggcgccaagc ttgtcatatg cgccccagag gtgccctgcg gcaacgcgac gaggaaactc       480
     gccaacaagc tgggcgtcac gttgaagccg gtgagcgagg aacagaaggt cactgatgtt       540
     cggggcaaag ttgagtctgg ggaagccgat gtggggatcg tctatcgcac ggacgcgctc       600
     gcggctggca acaaagtgga cgtgataccg atcggtcgag ccaatgaggt cgtcaatcat       660
     tacccgatag cgaccgcggt cggcgccacc caccagggcc tggctaaaag gttcgtcgag       720
     tacgtgatgt cggctgatgc ccagaagatc ctctcggatg atgggttttc cgggccgtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page