(data stored in ACNUC30630 zone)

EMBL: CP001977.NARH

CP001977.NARH        Location/Qualifiers
FT   CDS_pept        complement(575407..576930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="HMPREF0675_3556"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM TIGR01660"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00638"
FT                   /db_xref="GOA:D4HC22"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC22"
FT                   /protein_id="ADE00638.1"
FT                   /translation="MKVMAQIAMVMNLDKCIGCHTCSVTCKQAWTNREGTEYMWFNNVE
FT                   TRPGVGYPRGWEDQERWRGGWKRTRSGKLVPYQGGRLATLGKIFANPNLPAKKDYYEPW
FT                   TYEYDQLLASPSTQHIPTARAKSALTGEHKDTIDWGPNWDDDLGGSMETLDQDPVLHQM
FT                   NLTVRKSIEDSFMFYLPRICEHCLNPTCVSACPSGAIYKRAEDGIVLVDQDHCRGWRMC
FT                   VSGCPYKKVFFNHHSGKAEKCTLCYPRLEVGQPTVCSETCVGRLRYLGVLLYDADHVTW
FT                   AASQPDPRTLYAAQRDILLNPNDPEIITQAKANGVPHSWIKAAQASPVWQLISRYQIAL
FT                   PLHPEYRTLPMVWYVPPLSPVVDAVSASGNDGEDHRVLLAAISQMRIPLEYLAGLFTAG
FT                   ATAPVELSLRRLAAMRSYMRDIFLGNEADETIPEAVDMTGEDIQSMYRLLSIAKYDDRY
FT                   VIPTTCSGLPDGIADLGRCPVSGSLEAFHSISSPVSAPEGTPTLPLEVI"
     atgaaagtca tggcacagat cgcgatggtg atgaaccttg acaagtgcat cggctgccac        60
     acctgctcag tgacatgcaa acaggcctgg acaaaccgtg agggcacgga atacatgtgg       120
     tttaacaacg tcgagactcg gcccggcgtt ggctacccgc gcggctggga agatcaggaa       180
     cgctggaggg gaggctggaa gcgcacccgt tccgggaaac tggtccccta tcagggaggg       240
     cgtttggcca ccttaggcaa gattttcgcc aatccgaacc tgcccgccaa gaaggactac       300
     tacgagccgt ggacttacga atacgaccaa ctactggcgt ccccatcgac tcagcacatt       360
     cccactgccc gagcaaaatc agccctcacg ggtgagcaca aggacaccat cgactggggc       420
     cccaactggg atgacgatct tggtggctcc atggaaaccc tcgatcagga cccagtccta       480
     caccaaatga acctcacggt acgcaagtcc attgaggatt cattcatgtt ctatctgccg       540
     cgcatctgcg aacactgcct caacccgaca tgtgtttctg cctgcccatc tggggcgatc       600
     tacaagcgtg ccgaggatgg aatcgtcctt gtcgaccagg accattgtcg cggctggcgc       660
     atgtgtgtgt ccggctgccc gtataagaag gtgttcttca accatcacag cggcaaagcc       720
     gagaaatgca cactgtgcta tccacggctg gaagtcggac agccaacagt gtgctcggaa       780
     acttgcgttg gacgactgcg ctacctgggg gtgctcctct acgacgccga ccacgtcacc       840
     tgggccgcat ctcagcccga cccacgtacc ctgtacgccg cccagagaga catcctcctc       900
     aaccccaacg accccgaaat catcacacaa gccaaggcca acggcgtccc acactcttgg       960
     atcaaagcag cccaggcgtc accggtatgg cagctcatca gccgctatca gattgcccta      1020
     cccctgcacc ctgagtaccg aacactgccg atggtctggt acgtaccacc tctgtcacca      1080
     gtcgtcgacg ctgtcagcgc ttcgggcaac gacggggaag atcacagagt gctgttggcc      1140
     gcgatttccc agatgcgcat tccgcttgag tatctcgccg gcctattcac tgctggagcc      1200
     acggctccag ttgagctctc acttcgtcgt ctggctgcaa tgcgctccta catgcgagac      1260
     atctttttgg ggaatgaagc agacgaaacg atccccgagg cagtggacat gaccggcgag      1320
     gacatacaga gtatgtaccg actgctgtcc atcgccaagt acgacgaccg ctacgtcatt      1380
     cccaccacct gcagcggcct acccgacgga atcgccgacc tgggtcgctg ccccgtgagt      1440
     ggaagcctcg aagccttcca cagcatctcc tccccggtca gcgccccaga gggcacaccc      1500
     accttgccgc tggaggtgat ctga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page