(data stored in ACNUC30630 zone)

EMBL: CP001977.PE116

CP001977.PE116       Location/Qualifiers
FT   CDS_pept        137237..137374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99585"
FT                   /db_xref="GOA:D4HF56"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF56"
FT                   /protein_id="ADD99585.1"
FT                   /translation="MVPQPAPRKPRVVVKEPVMLDVIWLLGVIALFILLALCVKGVDAL
FT                   "
     gtggtgccac aaccggcacc ccggaaaccc cgggtcgtcg tcaaggagcc cgtcatgctc        60
     gacgtcatct ggctgctcgg tgtcatcgcc ttgttcatcc tgctcgccct gtgcgtgaag       120
     ggggtcgatg cgctatga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page