(data stored in ACNUC30630 zone)

EMBL: CP001977.PE12

CP001977.PE12        Location/Qualifiers
FT   CDS_pept        complement(15236..16204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3011"
FT                   /product="lactate/malate dehydrogenase, NAD binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3011"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99323"
FT                   /db_xref="GOA:D4HEH0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH0"
FT                   /protein_id="ADD99323.1"
FT                   /translation="MSIAPHLVVIGIGHVGSDVVTNAAALGLFSRISLIDVDKKVRDGQ
FT                   ALDNHQATAVAPAMTTTITAADYDACRSADVIIVSAGPSVLPDSYGGGHDSRNSLAQVN
FT                   SKVIREVMGNICQYTHSAPIILITNPLDVNVHIAATEFDYPTNLVVGTGTALDSARLRR
FT                   HLADWAGVSPDSVQAFMLGEHGATAFPYLSHASIGGLTLAEATTALGLQPLSPEQVGNS
FT                   VVQSAFDVLEGKGWTSSGISKAAVSLARAMLLDQRSIHPVCTLADGVLGFHGEVSLSLP
FT                   TVVSGHGVEHHLNIVLDEWEQEKLLVSAKAVREVYESVRPA"
     atgtcaattg caccgcacct cgtcgttatc gggatcggcc acgtcggctc ggacgtcgtc        60
     accaatgccg cagccttggg actcttctcg cgtatatcgc tcattgatgt cgacaaaaag       120
     gtccgtgacg gccaagctct cgacaaccac caggccaccg ccgtcgcccc cgccatgacg       180
     accaccatca cggcagccga ctatgacgca tgtcgcagcg ccgacgtcat catcgtctcc       240
     gctggtccct ccgtcctgcc tgacagctac ggcggcggcc atgactcacg taactcgctg       300
     gcccaagtca actcgaaggt catccgcgag gtgatgggca acatctgcca atacacccac       360
     agcgcaccca tcatcctcat tactaaccca ctagacgtta acgtccatat cgcggcaacc       420
     gagttcgact atccgacgaa cctcgtcgtt ggcaccggaa ccgccctcga ctcagcccga       480
     ctgcgccgtc acctagccga ctgggccggc gtcagtcccg actcggtgca agccttcatg       540
     ttgggagagc acggggcgac agcatttccc tacctctcgc atgcctctat cggtggtctg       600
     accctcgccg aggcgacgac cgccctgggg ctgcaaccgt tgtcccccga gcaggtgggc       660
     aacagcgtcg tacagtcggc cttcgatgtc cttgagggca agggctggac gtcctcgggt       720
     atctcgaagg cggcggtgag cttggcacgg gccatgctgc tcgaccaacg gtccatccat       780
     ccggtatgca cgctagccga cggggtgctg ggattccacg gtgaggtatc cctgtcgctg       840
     ccaacggtgg tcagtggcca cggggtcgaa catcacctca acatcgtctt ggacgagtgg       900
     gagcaagaga aactgttggt ctcggccaag gcggtacgag aggtctatga gtcggtgcgt       960
     ccagcctga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page